B7-H3 Protein, Mouse

€1,190.00

Shipping calculated at checkout

trenzyme SKU: P2020-003_500

Only 1 left!
Size: 500µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein containing the extracellular domain (ECD) of mouse CD276 with C-terminal His-Tag.

trenzyme cellebrity kolben
Overview
 Sequence Information Product Information Background Information
  • Product Name: B7-H3 Protein, Mouse
  • Catalog No.: P2020-003
  • RefSeq Links: UniProt: Q8VE98
  • Synonyms: B7 homolog 3; B7-H3 Protein, Mouse; B7H3 Protein, Mouse; B7RP-2 Protein; CD276
  • Species: Mus musculus, mouse
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 29-245):
    MVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNAS
    LRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQG
    VPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFP
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE/Coll. Coomassie
Histogram of marked lane in gel picture

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.