Cystatin C, His-Tag

€395.00

Shipping calculated at checkout

trenzyme SKU: P2020-186_100

Only 10 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Cystatin C is a small, non-glycosylated protein that acts as a potent inhibitor of cysteine proteases, such as cathepsins, which are involved in protein degradation within cells. It is produced by all nucleated cells and is freely filtered by the kidneys, making it a useful marker for assessing kidney function as represented by the glomerular filtration rate (GFR).

trenzyme cellebrity kolben
  • Product Name: Cystatin C, His-Tag
  • Catalog No.: P2020-186
  • RefSeq Links: HGNC:2475; NX_P01034; NP_000090.1; NM_000099.3; NP_001275543.1; NP_001275543.1NM_001288614.1; PDBe 3sva; UniProt: P01034
  • Synonyms: Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin
  • Species: Homo sapiens
  • Tags: His-tag, N-terminal
  • Sequence without tags (AA 27-146):
    SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGV
    NYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
  • Expression Host: E. coli
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 90 % as determined by SDS-PAGE
  • Application: ELISA, Bioassay

Cystatin C is expressed by all nucleated cells at a constant rate and plays a protective role by tightly regulating cysteine protease activity in various tissues, thereby balancing cellular homeostasis and preventing damage from excessive proteolytic activity. In particular, Cystatin C inhibits lysosomal cysteine proteases, such as cathepsins B, H, K, L and S, which are involved in protein degradation within cells. Since cathepsins are also involved in the remodeling of the extracellular matrix (ECM), which is critical in processes like wound healing and tissue regeneration, their inhibition by Cystatin C regulates ECM turnover, preventing excessive degradation. Moreover, Cystatin C is able to influence immune responses by regulating the activity of proteases involved in antigen processing and presentation. In the central nervous system, Cystatin C fulfills a neuroprotective role, as dysregulation of proteolytic enzymes is associated with neurodegenerative disorders, such as Alzheimer’s disease. Due to its consistent production and filtration by the kidneys, Cystatin C is a useful biomarker for assessing kidney function. In disease states, Cystatin-C levels often increase as a marker of tissue damage, inflammation, or declining renal function, making it a valuable biomarker in diagnosing and monitoring conditions like chronic kidney disease, cardiovascular disease, neurodegeneration, and cancer.

Additional information for Cystatin C, His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for Cystatin C His-Tag
Histogram for Cystatin C His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.