Furin, GFP/His-tag

€990.00

Shipping calculated at checkout

trenzyme SKU: P2020-119_100

Only 1 left!
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant Furin protease containing a GFP/His-tag produced in mammalian cell system (HEK cells). The protease cleaves proteins just downstream of a basic amino acid target sequence thereby processing cellular precursor proteins and activating toxins like Anthrax or viral proteins like SARS-CoV-2 Spike protein.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: Furin, GFP/His-Tag
  • Catalog No.: P2020-119
  • RefSeq Links: UniProt: P09958; NP_001276752.1; NM_001289823.1; NP_001276753.1; NM_001289824.1; NP_002560.1; NM_002569.3; PIR: A39552; GeneID: 5045
  • Synonyms: Furin (Paired Basic Amino Acid Cleaving Enzyme); PCSK3; PACE; FUR; SPC1; Paired Basic Amino Acid Residue-Cleaving Enzyme; EC 3.4.21.75; Paired Basic Amino Acid Cleaving Enzyme (Furin, Membrane Associated Receptor Protein); Proprotein Convertase Subtilisin/Kexin; EC 3.4.21
  • Species: Homo sapiens, human
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 27-715):
    MQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHS
    RLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGH
    GIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAV
    ANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDG
    PARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGN
    VPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEAN
    KNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVA
    PQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHL
    VSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTK
    FTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDT
    HYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRES
    PPQQQPPRLPPEVEAGQRLRAGLLPSHLPE
  • Expression Host: human, HEK293
  • Formulation: PBS; pH 7.4.
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 85% as determined by SDS-PAGE

Furin, also known as paired basic Amino acid Cleaving Enzyme (PACE) is a ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg˅. However, the enzyme prefers the site Arg-X-Lys/Arg-Arg˅.
It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms.
Substrates of Furin include blood clotting factors, serum proteins and growth factor receptors such as the insulin-like growth factor receptor but also viral proteins like the SARS-CoV-2 Spike protein.
Furin is inhibited by EGTA, α1- Antitrypsin Portland and polyarginine compounds.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of Furin, GFP/His-Tag
Histogram (of marked lane in gel picture) Furin, GFP/His-Tag

Download Product Information for Furin, GFP/His-Tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Cartoon character wearing a lab coat and headset, pointing and giving a thumbs-up while presenting trenzymes friendly laboratory expert the chatbot named Zymi asks "How can I help you today?"

Do you need a quote for an individual request or a bulk order?

Contact Us