hCELA3A, GFP/His-Tag

• Product Name: hCELA3A, GFP/His-Tag
  
• Catalog No.: P2020-108
• RefSeq Links: UniProt: P09093
• Synonyms: Chymotrypsin-like elastase family member 3A; Elastase IIIA; Elastase-3A; ELA3; ELA3A; Protease E; OTTHUMP00000002835; elastase 3A; pancreatic

• Species: Homo sapiens, human
• Tags: GFP/His-Tag, C-terminal
• Sequence without tags (AA 18-270):
  YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISR
  DLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGD
  AVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGST
  VKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVS
  AFIDWIEETIASHV
  

• Expression Host: human, HEK293
• Formulation: PBS, pH 7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 95% as determined by SDS-PAGE

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3A has only little elastolytic activity. CELA3A is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. The protein contains GFP as fusion partner at the C-terminal end.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for hCELA3A, GFP/His-Tag