human CD19, GFP/His-Tag

€390.00

Shipping calculated at checkout

trenzyme SKU: P2020-156_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Cluster of differentiation 19 (CD19) is a cell surface glycoprotein that plays a pivotal role in B cell development and function. It is expressed on the surface of B cells from early pre-B cell stages to mature B cells and is involved in B cell receptor (BCR) signaling and activation. Due to its consistent expression on B cell malignancies, such as B cell lymphomas and leukemia, CD19 has emerged as a key target for immunotherapies. Chimeric antigen receptor (CAR) T cell therapies directed against CD19 have demonstrated remarkable success in treating these malignancies.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: human CD19, GFP/His-Tag
  • Catalog No.: P2020-156
  • RefSeq Links: HGNC:1633; NX_P15391; NP_001171569.1; NM_001178098.1; PDBe 7urx UniProt: P15391
  • Synonyms: CD19 antigen, Differentiation antigen CD19, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, B4, T-cell surface antigen Leu-12, CVID3, MGC12802
  • Species: Homo sapiens
  • Tags: GFP/His-tag, C-terminal
  • Sequence without tags (AA 21-291):
    MEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNV
    SQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKL
    MSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHV
    HPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWH
    WLLRTGGWK
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 75 % as determined by SDS-PAGE
  • Application: ELISA, WB, Immunostaining, Functional assay

The B lymphocyte antigen CD19 is a cell surface glycoprotein expressed on B cells from early pre-B cell stages to mature B cells. Thus, CD19 is useable as reliable marker for B cell lineage. CD19 is a member of the immunoglobulin superfamily and consists of extracellular immunoglobulin-like domains, a transmembrane region, and a cytoplasmic tail. It collaborates with the B cell receptor (BCR) complex to transmit signals that are essential for B cell survival, proliferation, and differentiation. More precisely, CD19 enhances the binding of the complement component C3d to its receptor CD21 (complement receptor CR2), which is a component of the BCR complex. This leads to the formation of a multi-molecular complex that amplifies BCR signaling and is essential for an enhanced responsiveness of B cells to antigens. Consequently, CD19 is crucial for optimizing B cell activation and promoting effective immune responses. In addition, CD19 forms a complex with CD81, which is a tetraspanin protein associated with B cell membranes. This complex contributes to the organization and stabilization of B cell membrane microdomains and is also implicated in the regulation of B cell signaling.

Due to its sustained presence in B cell malignancies, CD19 represents an attractive target for immunotherapeutic interventions. Chimeric antigen receptor (CAR) T cell therapies directed against CD19 have demonstrated remarkable success in treating B cell lymphomas and leukemia. Despite these successes, challenges such as antigen escape variants and long-term safety considerations are subjects of ongoing research to optimize the clinical application of CD19-directed therapies.

Mutations in CD19 lead to severe immunodeficiency syndromes characterized by decreased antibody production. Furthermore, dysregulation of CD19 expression or function is associated with the development and progression of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. In autoimmune diseases, B cells may become hyperactive, producing autoantibodies that target self-antigens, contributing to tissue damage and inflammation.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human CD19
Histogram of human CD19

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us