human IL-6, His-tag

• Species: Homo sapiens
• Tags: His-tag, C-terminal
• Sequence without tags (AA 30-212):
  MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAEN
  NLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
  VLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRA
  LRQM
  

• Expression Host: HEK293
  
• Formulation: PBS; pH 7.4.
• Format: Liquid, stored and shipped at -80 °C
• Purity: > 85% as determined by SDS-PAGE
  
• Application: ELISA, WB, Functional assay

Interleukin-6 (IL-6) is an important pro-inflammatory cytokine, which belongs to the type I cytokine family and is produced by a variety of cell types, including mononuclear phagocytes, dendritic cells, vascular endothelial cells and fibroblasts. Signaling is induced by binding of IL-6 to the cytokine-binding polypeptide chain IL-6R alpha, leading to association of IL-6R alpha with the signal-transducing subunit gp130, together constituting the IL-6 receptor. Expression of the classical IL-6 receptor is restricted to hepatocytes, monocytes, some resting lymphocytes and some epithelial cells. Remarkably, alternative splicing and proteolytic cleavage generate soluble forms of IL-6R alpha allowing IL-6 trans-signaling by binding of IL-6/IL-6R alpha complexes to gp130-expressing cells. Thereby, the range of IL-6 responsive cells is markedly increased as gp130 is ubiquitously expressed.

Both pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs) induce the secretion of IL-6, which has both local and systemic effects. Next to IL-6, tumor necrosis factor (TNF)-alpha and IL-1 beta are produced, which promote further synthesis of IL-6.

IL-6 is a crucial mediator of the acute phase response and fever. It stimulates the synthesis of acute phase reactants by hepatocytes, such as the C-reactive protein (CRP), serum amyloid A (SAA) and fibrinogen, and inhibits production of albumin, transferrin and fibronectin. Furthermore, IL-6 secretion leads to increased production of neutrophils in the bone marrow.

The differentiation of naïve CD4⁺ T cells into IL-17 producing helper T cells is stimulated by IL-6, whereas differentiation into regulatory T cells is concomitantly inhibited. Additionally, IL-6 promotes differentiation of activated B cells into antibody-producing plasma cells, all of which contributes to acquired immunity.

However, dysregulation of IL-6 production causes several chronic inflammatory diseases and autoimmunity. Overproduction of IL-6 has been detected in the synovial cells of rheumatoid arthritis, swollen lymph nodes of the Castleman’s disease, myeloma cells, and peripheral blood cells. With tocilizumab, a humanized monoclonal antibody, an effective therapeutic drug targeting IL-6 signaling cascades has been developed to treat immune-mediated diseases.

In contrast to its pro-inflammatory properties, IL-6 also acts as an anti-inflammatory myokine, which is a cytokine produced by contracting muscle cells.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for human IL-6, His-tag