human Interleukin-1 beta, tag-free

€310.00

Shipping calculated at checkout

trenzyme SKU: P2020-136_20

Available Now!

Size: 20µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Interleukin-1 beta (IL-1 beta) is a pivotal pro-inflammatory cytokine mediating innate and adaptive immune responses in response to infection or cell injury. Moreover, IL-1 beta is involved in a variety of autoimmune and inflammatory diseases caused by enhanced secretion of the cytokine. In further consequence, chronic inflammatory conditions promote tumor development and cancer malignancy.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: human Interleukin-1 beta, tag-free
  • Catalog No.: P2020-136
  • RefSeq Links: NP_000567.1; NM_000576.2; pdb1tp0 UniProt: P01584
  • Synonyms: IL-1 beta; Catabolin; IL-1B, IL-1 beta Protein; IL1-BETA Protein; IL1F2 Protein
  • Species: Homo sapiens
  • Tags: Tag-free; His-tag removed by proteolytic digest
  • Sequence without tags (AA 117-269):

    MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
    LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPN
    WYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

  • Expression Host: E. coli
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: 95% as determined by SDS-PAGE


The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1, which is activated by a cytosolic pro-inflammatory signaling complex, the inflammasome. Proteolytic cleavage of pro-IL-1 beta results in secretion of mature IL-1 beta and induction of inflammatory responses by binding to the IL-1 type I receptor (IL-1RI). In particular, activation of IL-1 beta induces inflammation, fever, synthesis of acute phase proteins, as well as proliferation and differentiation of lymphocytes emphasizing its versatile biological functions. Activity is further regulated by several endogenous inhibitors including IL-1 type II receptor (IL-1RII) and IL-1 receptor antagonist (IL-1Ra). Dysregulation causes pathological conditions ranging from chronic inflammatory and autoinflammatory diseases to autoimmune syndromes, neurodegenerative diseases and cancer.

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS Page of human IL-1 beta tag-free
Histogram of human IL-1 beta tag-free

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us