Lanmodulin (LanM)

• Species: Methylorubrum extorquens
• Tags: His-Tag, C-terminal
• Sequence without tags (AA 1-133):
  

  MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDP
  DKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDAREL
  ASPAGSALVNLIR

• Expression Host: E. coli
• Formulation: PBS; pH 7.4.
• Format: Liquid, stored and shipped at -80°C
• Purity: > 95% as determined by SDS-PAGE

Lanthanides (Lns) are essential cofactors in certain enzymes. Lanmodulin (LanM) is a metal binding protein found in several lanthanide-utilizing, methylotrophic bacteria like Methylorubrum sp. The protein exhibits unique metal-binding properties and binds rare-earth elements (REEs) with very high affinity, often better than many synthetic chelators. LanM-REE complexes are stable at extreme conditions like high temperature, repeated acid treatments down to pH 2.5 and up to molar amounts of competing non-REE metal ions.
Therefore, lanmodulin could be used even in harsh chemical processes for selective recovery of a broad range of REE from precumbustion coal and electronic waste leachates.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for LanM