pro-activin A, GFP/His-tag

€649.00

Shipping calculated at checkout

trenzyme SKU: P2020-121_100

Only 5 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Human pro-activin A represents the latent complex of activin A composed of the N-terminal pro-domain and the highly conserved mature domain.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: pro-activin A, GFP/His-tag
  • Catalog No.: P2020-121
  • RefSeq Links: UniProt: P08476; NP_002183.1; 10.2210/pdb1nys/pdb
  • Synonyms: Activin beta-A chain; Erythroid differentiation protein (EDF); latent Activin A protein; inhibin beta A chain; inhibin beta A subunit
  • Species: Homo sapiens, human
  • Tags: GFP/His-tag, N-terminal
  • Sequence without tags (AA 21 - 426):
    MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVP
    KAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFE
    ISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKG
    ERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGK
    KKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLXXXG
    LECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHST
    VINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS

    XXX indicates position of His-tag.
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Activin A belongs to the TGF-beta superfamily of cytokines and is a disulfide-linked homodimer consisting of four inhibin betaA chains. Any acitivin is expressed as latent complex, in which the pro-domain of activin is noncovalently linked to the mature, bioactive domain. Activation of activins is induced by proteolytically cleavage of the aminoterminal pro-domain resulting in the formation of disulfide-linked dimers of the bioactive protein. Activity of activin A is highly regulated by follistatin and inhibins. Activin A plays important roles in a variety of physiological and pathological processes, including tissue morphogenesis and repair, fibrosis, inflammation, neural development and development of the reproductive system. Moreover, activin A is involved in hematopoesis as well as in carcinogenesis. Due to its pivotal role in cell proliferation and differentiation, activin A is commonly used for the maintainance of pluripotency in induced pluripotent stem cell (iPSC) and embryonic stem cell (ESC) culture and additionally, to drive differentiation of stem cells into hepatocytes and pancreatic cells. To increase the functionality for diagnostics and other applications, pro-activin A is fused to GFP.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of pro-activin A, GFP/His-tag
Histogram (of marked lane in gel picture) of pro-activin A, GFP/His-tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us