B7-H3 Protein, Human

€320.00

Shipping calculated at checkout

trenzyme SKU: P2020-002_100

Sold Out
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein containing the extracellular domain (ECD) of human CD276, Isoform 2 with C-terminal His-Tag.

trenzyme cellebrity kolben
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: B7-H3 Protein, Human
  • Catalog No.: P2020-002
  • RefSeq Links: UniProt: Q5ZPR3-2
  • Synonyms: B7-H3 Protein, Human; B7H3 Protein, Human; B7RP-2 Protein; CD276
  • Species: Homo sapiens, human
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 29-245):
    MLEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNA
    SLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQG
    VPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE/Coll. Coomassie
Histogram of marked lane in gel picture

Download Product Information for B7-H3 Protein, Human

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.