human Interleukin-1 beta, tag-free

• Species: Homo sapiens
• Tags: Tag-free; His-tag removed by proteolytic digest
• Sequence without tags (AA 117-269):
  

  MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
  LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPN
  WYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Expression Host: E. coli
• Formulation: PBS; pH 7.4
• Format: Liquid, stored and shipped at -80° C
• Purity: 95% as determined by SDS-PAGE

The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1, which is activated by a cytosolic pro-inflammatory signaling complex, the inflammasome. Proteolytic cleavage of pro-IL-1 beta results in secretion of mature IL-1 beta and induction of inflammatory responses by binding to the IL-1 type I receptor (IL-1RI). In particular, activation of IL-1 beta induces inflammation, fever, synthesis of acute phase proteins, as well as proliferation and differentiation of lymphocytes emphasizing its versatile biological functions. Activity is further regulated by several endogenous inhibitors including IL-1 type II receptor (IL-1RII) and IL-1 receptor antagonist (IL-1Ra). Dysregulation causes pathological conditions ranging from chronic inflammatory and autoinflammatory diseases to autoimmune syndromes, neurodegenerative diseases and cancer.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for human Interleukin-1 beta, tag-free