Arg-C, His-Tag

€395.00

Shipping calculated at checkout

trenzyme SKU: P2020-187-100

Available Now!

Size: 100µg
Tag: His-Tag C-terminal

Need a quote for an individual request or for a bulk order? Please contact us

Description

Arg-C, also known as Clostripain, is a heterodimeric cysteine endopeptidase from Hathewaya histolytica (formerly Clostridium histolyticum), cleaves peptide bonds at the C-terminus of arginine, even when followed by proline. It also cleaves lysine, but at a slower rate. Activated by sulfhydryl reagents and requiring Ca2+, Arg-C is valuable in proteomics, complementing trypsin digestion for enhanced protein identification and PTM analysis in mass spectrometry.

trenzyme cellebrity kolben
  • Product Name: Arg-C, His-Tag
  • Catalog No.: P2020-187 / P2020-188
  • RefSeq Links: UniProt: P09870
  • Synonyms: Clostripain, Clostridiopeptidase B, Proteinase
  • Species: Hathewaya histolytica (Clostridium histolyticum)
  • Tags: His-Tag, C-terminal / His-Tag, N-terminal
  • Sequence without tags (AA 28-526):
    MNPVTKSKDNNLKEVQQVTSKSNKNKNQKVTIMYYCDADNNLEGSLLNDIEEMKTGYKDS
    PNLNLIALVDRSPRYSSDEKVLGEDFSDTRLYKIEHNKANRLDGKNEFPEISTTSKYEAN
    MGDPEVLKKFIDYCKSNYEADKYVLIMANHGGGAREKSNPRLNRAICWDDSNLDKNGEAD
    CLYMGEISDHLTEKQSVDLLAFDACLMGTAEVAYQYRPGNGGFSADTLVASSPVVWGPGF
    KYDKIFDRIKAGGGTNNEDDLTLGGKEQNFDPATITNEQLGALFVEEQRDSTHANGRYDQ
    HLSFYDLKKAESVKRAIDNLAVNLSNENKKSEIEKLRGSGIHTDLMHYFDEYSEGEWVEY
    PYFDVYDLCEKINKSENFSSKTKDLASNAMNKLNEMIVYSFGDPSNNFKEGKNGLSIFLP
    NGDKKYSTYYTSTKIPHWTMQSWYNSIDTVKYGLNPYGKLSWCKDGQDPEINKVGNWFEL
    LDSWFDKTNDVTGGVNHYQW
  • Sequence without tags (AA 50-526):
    NKNQKVTIMYYCDADNNLEGSLLNDIEEMKTGYKDSPNLNLIALVDRSPRYSSDEKVLGE
    DFSDTRLYKIEHNKANRLDGKNEFPEISTTSKYEANMGDPEVLKKFIDYCKSNYEADKYV
    LIMANHGGGAREKSNPRLNRAICWDDSNLDKNGEADCLYMGEISDHLTEKQSVDLLAFDA
    CLMGTAEVAYQYRPGNGGFSADTLVASSPVVWGPGFKYDKIFDRIKAGGGTNNEDDLTLG
    GKEQNFDPATITNEQLGALFVEEQRDSTHANGRYDQHLSFYDLKKAESVKRAIDNLAVNL
    SNENKKSEIEKLRGSGIHTDLMHYFDEYSEGEWVEYPYFDVYDLCEKINKSENFSSKTKD
    LASNAMNKLNEMIVYSFGDPSNNFKEGKNGLSIFLPNGDKKYSTYYTSTKIPHWTMQSWY
    NSIDTVKYGLNPYGKLSWCKDGQDPEINKVGNWFELLDSWFDKTNDVTGGVNHYQW
  • Expression Host: E.coli
  • Formulation: 25 mM HEPES, 5 mM CaCl2, 2 M Urea; pH 7.6
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 90 % as determined by SDS-PAGE / > 80 % as determined by SDS-PAGE
  • Application: Mass Spectrometry Analysis

Arg-C, also known as clostripain, is a heterodimeric cysteine endopeptidase derived from Hathewaya histolytica (Clostridium histolyticum). It specifically cleaves peptide bonds at the C-terminus of arginine residues, including those followed by proline, making it a valuable tool in proteomics research. Additionally, Arg-C can cleave lysine residues, albeit at a lower rate. This enzyme is activated by sulfhydryl reagents and requires calcium ions for optimal activity. Its unique specificity complements trypsin digestion, enhancing protein identification and post-translational modification analysis in mass spectrometry applications.
The use of Arg-C offers several advantages in protein analysis. It provides an alternative to trypsin, which can sometimes produce large peptides difficult to analyze by mass spectrometry. By generating a different set of peptides, Arg-C can improve the coverage of protein sequences and help identify specific modifications or mutations. This enzyme is particularly useful in studies requiring detailed structural information or when analyzing proteins with complex post-translational modifications. Overall, Arg-C is a versatile enzyme that expands the capabilities of proteomic research by offering complementary digestion strategies.

Additional information for Arg-C, His-Tag, C-terminal

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

ArgC His-Tag SDS-Page
ArgC His-Tag Histogram

Additional information for Arg-C, His-Tag, N-terminal

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

ArgC His-Tag SDS-Page
ArgC His-Tag Histogram

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.