PowerNuclease, His-Tag

€199.00

Shipping calculated at checkout

trenzyme SKU: P2020-176_100

Only 4 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Nuclease from Serratia marcescens (Sm nuclease) is an endonuclease, which cleaves DNA or RNA at internal phosphodiester bonds. Due to its robust enzymatic activity, thermal stability, and resistance to various inhibitors, Sm nuclease has become a versatile tool for DNA manipulation and nucleic acid analysis.
This nuclease is also known as Benzonase® (Benzonase is a trademark of Merck KGaA, Darmstadt, Germany).

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: PowerNuclease, His-Tag
  • Catalog No.: P2020-176
  • RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717
  • Synonyms: Nuclease, Endonuclease, Benzonase® 
  • Species: Serratia marcescens
  • Tags: His-tag, N-terminal
  • Sequence without tags (AA 22-266):
    MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNW
    KTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLN
    QGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNS
    PAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPE
    LMGCKN
  • Expression Host: E. coli
  • Formulation: 20 mM Tris, 20 mM NaCl, 2 mM MgCl2, 50 % Glycerol; pH 8.0
  • Format: Liquid, stored and shipped at -20° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: for cell lysis

Nuclease from Serratia marcescens (Sm nuclease) is a well-characterized extracellular endonuclease with unique properties originally isolated from the bacterium Serratia marcescens. It catalyzes the hydrolysis of both single-stranded and double-stranded DNA and RNA molecules, generating 5’-phosphate and 3’-hydroxyl termini. Metal ions, typically magnesium or manganese, coordinate within the active site and play a crucial role in catalysis by stabilizing the transition state during phosphodiester bond cleavage. Unlike some nucleases that require specific sequence motifs for substrate recognition, Sm nuclease exhibits non-specific endonuclease activity cleaving nucleic acids at random sites along the phosphate backbone. Its robust enzymatic activity and versatility, makes it particularly useful for various biotechnological applications, such as DNA and RNA purification, removal of nucleic acid contaminants from protein samples, generation of cohesive ends for cloning, and site-directed mutagenesis. Furthermore, Sm nuclease is beneficial in various nucleic acid manipulation techniques, including restriction enzyme digest, DNA footprinting, and next-generation sequencing library preparation.
This nuclease is also known as Benzonase® (Benzonase is a trademark of Merck KGaA, Darmstadt, Germany).

Additional information for PowerNuclease, His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for PowerNuclease His-Tag
Histogram for PowerNuclease His-Tag

Download Product Information PowerNuclease, His-Tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us