Catalase

$1,075.00

Shipping calculated at checkout

trenzyme SKU: P2020-127_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Catalase (KatA) from Helicobacter pylori is an enzyme used as biomarker for diagnostic of duodenal ulcer (DU).

trenzyme cellebrity kolben
  • Product Name: Catalase
  • Catalog No.: P2020-127
  • RefSeq Links: UniProt: P77872; NP_207669.1; NC_000915.1; WP_000247370.1;, NC_018939.1; PDB: 1QWL; 2IQF
  • Synonyms: KatA
  • Species: Helicobacter pylori
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 1-505):

    MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
    GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
    EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWV
    MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPD
    SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELN
    KNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
    CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
    DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
    KALEKHQKMMKDMHGKDMHHTKKKK

  • Expression Host: E. coli
  • Formulation: PBS; pH 7.4.
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 75% as determined by SDS-PAGE

Catalases are conserved and abundant enzymes found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor.
KatA is used as biomarker for duodenal ulcer (DU) and also for gastritic cancer (GC).

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of Catalase
Histogram (of marked lane in gel picture) Catalase

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.