Catalase

€899.00

Shipping calculated at checkout

trenzyme SKU: P2020-127_100

Available Now!
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Catalase (KatA) from Helicobacter pylori is an enzyme used as biomarker for diagnostic of duodenal ulcer (DU).

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: Catalase
  • Catalog No.: P2020-127
  • RefSeq Links: UniProt: P77872; NP_207669.1; NC_000915.1; WP_000247370.1;, NC_018939.1; PDB: 1QWL; 2IQF
  • Synonyms: KatA
  • Species: Helicobacter pylori
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 1-505):

    MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
    GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
    EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWV
    MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPD
    SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELN
    KNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
    CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
    DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
    KALEKHQKMMKDMHGKDMHHTKKKK

  • Expression Host: E. coli
  • Formulation: PBS; pH 7.4.
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 75% as determined by SDS-PAGE

Catalases are conserved and abundant enzymes found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor.
KatA is used as biomarker for duodenal ulcer (DU) and also for gastritic cancer (GC).

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of Catalase
Histogram (of marked lane in gel picture) Catalase

Download Product Information for Catalase

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Cartoon character wearing a lab coat and headset, pointing and giving a thumbs-up while presenting trenzymes friendly laboratory expert the chatbot named Zymi asks "How can I help you today?"

Do you need a quote for an individual request or a bulk order?

Contact Us