PsiMP glycosidase

€790.00

Shipping calculated at checkout

trenzyme SKU: P2020-109_100

Only 5 left!
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

The PsiMP glycosidase biologically has a cleavage function and catalyzes the reversible cleavage of the C-C glycoside bond to form ribose-5-phosphate and uracil. PsiMP glycosidase, together with the enzyme pseudouridine kinase, is responsible for the degradation of pseudouridine in E. coli.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: PsiMP glycosidase
  • Catalog No.: P2020-109
  • RefSeq Links: UniProt: P33025
  • Synonyms: Pseudouridine 5’-phosphate glycosidase; PsiMP glycosidase
  • Species: Escherichia coli; Salmonella sp. HNK130
  • Tags: His-Tag, N-terminal
  • Sequence without tags (AA 1-312):
    MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPF
    PQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPF
    VVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVV
    CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV
    KWQSGLNGGLVVANPIPEQFAMPEHTINAAIDQAVAEAEAQGVIGKESTPFLLARVAELT
    GGDSLKSNIQLVFNNAILASEIAKEYQRLAG
  • Expression Host: E. coli
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

The enzymes PsiMP glycosidase and pseudouridine kinase are encoded by separate genes in bacterial genomes. PsiMP glycosidase is encoded by the yeiN gene, and pseudouridine kinase is encoded by the yeiC gene. Both genes belong to the same operon. In humans and other higher organisms, pseudouridine kinase and PsiMP glycosidase are not found. However, they are present in some eukaryotes as the only bifunctional enzymes.
In the process of pseudouridine degradation, when pseudouridine kinase phosphorylates pseudouridine, pseudouridine 5'-phosphate (PsiMP) is formed as a degradation product of RNAs. PsiMP is a non-classical nucleoside that has a glycosidic C-C bond and is present in human urine.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of PsiMP glycosidase
Histogram (of marked lane in gel picture) PsiMP glycosidase

Download Product Information for PsiMP glycosidase

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Cartoon character wearing a lab coat and headset, pointing and giving a thumbs-up while presenting trenzymes friendly laboratory expert the chatbot named Zymi asks "How can I help you today?"

Do you need a quote for an individual request or a bulk order?

Contact Us