hCELA3A, His-Tag; inactive variant S217A

• Product Name: hCELA3A, His-Tag; inactive variant S217A
  
• Catalog No.: P2020-129
• RefSeq Links: UniProt: P09093
• Synonyms: Chymotrypsin-like elastase family member 3A; Elastase IIIA; Elastase-3A; ELA3; ELA3A; Protease E; OTTHUMP00000002835; elastase 3A; pancreatic; inactive variant; catalytically inactive

• Species: Homo sapiens, human
• Tags: His-Tag, C-terminal
• Sequence without tags (AA 16-270):
  

  MSGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT  YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAG  DILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGC  NGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASHVLVPRGSAAA
  LE

• Expression Host: human, HEK293
• Formulation: PBS, pH 7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 90% as determined by SDS-PAGE

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3A has only little elastolytic activity. CELA3A is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. The amino acid S217 of CELA3A is part of the catalytic triade typical for all serine proteases. By substitution of this amino acid by a different one (S217A), the enzyme is loosing its catalytic activity.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for hCELA3A, His-Tag ; inactive variant S217A