SARS-CoV-2 S-Protein Beta, B.1.351 (South Africa), His-Tag, Trimer

$827.00 $935.00 Save $108

Shipping calculated at checkout

trenzyme SKU: P2020-044_100

Only 6 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant Spike protein of SARS-CoV-2 Beta variant, B.1.351 (South Africa) with C-terminal Strep- and His-Tag as a stabilized trimer and with deletion of the internal Furin-site.
The Beta variant is characterized by the following mutations: L18F, D80A, D215G, R246I, K417N, E484K, N501Y, D614G, A701V. Some of these mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor, which results in increased transmissibility of the SARS-CoV-2 virus.

trenzyme cellebrity kolben
  • Product Name: SARS-CoV-2 S protein (N501Y, E484K, K417N), His-Tag, Trimer
  • Catalog No.: P2020-044
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike protein; S glycoprotein; spike glycoprotein; 2019-nCoV; COVID-2019; COVID-19; Beta-variant; B.1.351; B1351; 20H/501Y.V2
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag and Strep-Tag, both C-terminal
  • Sequence without tags (AA 16-1208):
    MVNFTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN
    GTKRFANPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ
    FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF
    KNIDGYFKIYSKHTPINLVRGLPQGFSALEPLVDLPIGINITRFQTLLALHISYLTPGDS
    SSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQ
    TSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF
    STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVI
    AWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQS
    YGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTE
    SNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQG
    VNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASY
    QTQTNSPGASVASQSIIAYTMSLGVENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSV
    DCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKD
    FGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN
    GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVL
    YENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV
    LNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQ
    SKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV
    SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYF
    KNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, 5% (w/v) Trehalose; pH 7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 85% as determined by SDS-PAGE

The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies. The engineered recombinant Spike protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer.
Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 20H/501Y.V2, also known as lineage B.1.351 or Beta variant, exhibits several mutations. Compared to the previously circulating variants, the mutation E484K may affect neutralization by some polyclonal and monoclonal antibodies. Furthermore, the mutation N501Y may influence the binding affinity of the spike protein to hACE2. Therefore, the N501Y mutation is considered the most dangerous modification of the virus resulting in a higher transmissibility.

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S-Protein Beta, B.1.351 (South Africa), His-Tag, Trimer
Histogram (of marked lane in gel picture) of SARS-CoV-2 S-Protein Beta, B.1.351 (South Africa), His-Tag, Trimer

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.