SARS-CoV-2 S-Protein Beta, B.1.351 (South Africa), His-Tag, Trimer
€690.00 €780.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-044 trenzyme
Description
Recombinant Spike protein of SARS-CoV-2 Beta variant, B.1.351 (South Africa) with C-terminal Strep- and His-Tag as a stabilized trimer and with deletion of the internal Furin-site.
The Beta variant is characterized by the following mutations: L18F, D80A, D215G, R246I, K417N, E484K, N501Y, D614G, A701V. Some of these mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor, which results in increased transmissibility of the SARS-CoV-2 virus.
Overview
- Product Name: SARS-CoV-2 S protein (N501Y, E484K, K417N), His-Tag, Trimer
- Catalog No.: P2020-044
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
- Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike protein; S glycoprotein; spike glycoprotein; 2019-nCoV; COVID-2019; COVID-19; Beta-variant; B.1.351; B1351; 20H/501Y.V2
Customer Testimonial
“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
- Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: His-Tag and Strep-Tag, both C-terminal
-
Sequence without tags (AA 16-1208):
MVNFTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN
GTKRFANPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ
FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF
KNIDGYFKIYSKHTPINLVRGLPQGFSALEPLVDLPIGINITRFQTLLALHISYLTPGDS
SSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQ
TSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF
STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVI
AWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQS
YGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTE
SNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQG
VNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASY
QTQTNSPGASVASQSIIAYTMSLGVENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSV
DCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKD
FGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN
GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVL
YENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV
LNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQ
SKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV
SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYF
KNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK
X indicates mutation sites
Product Information
- Expression Host: human, HEK293
- Formulation: PBS, 5% (w/v) Trehalose; pH 7,4
- Format: Liquid, stored and shipped at -80 °C
- Purity: > 85% as determined by SDS-PAGE
Background Information
The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies. The engineered recombinant Spike protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer.
Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 20H/501Y.V2, also known as lineage B.1.351 or Beta variant, exhibits several mutations. Compared to the previously circulating variants, the mutation E484K may affect neutralization by some polyclonal and monoclonal antibodies. Furthermore, the mutation N501Y may influence the binding affinity of the spike protein to hACE2. Therefore, the N501Y mutation is considered the most dangerous modification of the virus resulting in a higher transmissibility.
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |