SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

• Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (Y453F))
  
• Catalog No.: P2020-033
• RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
• Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (Y453F); Danish Mink mutation; Cluster 5 Mutation; ΔFVI spike
  

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  
• Tags: His-Tag, C-terminal
• Sequence without tags (AA 319-541):
  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
  DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLFRLFRKSNLKPFERDISTEIYQAG
  STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  
  X indicates mutation site
  

• Expression Host: human, HEK293
• Formulation: PBS, pH  7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 80% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A mutation first discovered in Denmark, called “Cluster 5”, also known as the ΔFVI-spike, is related to four genetic changes. This mutation (Y453F) is located in a conservative region of the RBD directly involved in ACE2 binding and thereby could have implications for viral fitness, transmissibility, and antigenicity.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD, Mutant (Y453F))