SARS-CoV-2 S1 (RBD) Omicron B.1.1.529, BA.2, GFP/His-Tag

• Product Name: SARS-CoV-2 S1 (RBD) (Omicron Variant B.1.1.529 BA.2), GFP/His-tag (cleavable)
  
• Catalog No.: P2020-062
• RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2; Genebank Accession: #QHD43416.1
• Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493K, G496S, Q498R, N501Y, Y505H); Omicron; B.1.1.529; South Africa; Botswana; GISAID clade: GISAID clade GR/484A; Nextstrain clade 21K; variant of concern (VOC); Stealth variant
  

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  
• Tags: GFP/His-Tag, C-terminal
• Sequence without tags (AA 319-541):
  

  MRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAF
  KCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWN
  SNKLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYGF
  RPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  
  X indicates mutation sites

• Expression Host: human, HEK293
• Formulation: PBS, pH  7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process.
During the actual COVID-19 pandemic, several variants of the virus evolved and some of them are continuously spreading all over the world.
This SARS-CoV-2 variant assigned as "Omicron" by the World Health Organization (WHO) belongs to Pango lineage B.1.1.529. It is characterised by 30 changes, three small deletions and one small insertion in the spike protein, of these, 15 are in the receptor binding domain. Since the Omicron variant is the most divergent variant that has been detected in significant numbers during the pandemic so far, many concerns raised that it may be associated with increased transmissibility, significant reduction in vaccine effectiveness and increased risk for reinfections. Actually, researchers all over the world are looking with the highest priority into any potential impact the Omicron variant has on the effectiveness of COVID-19 vaccines. As of 26 November 2021, ECDC has classified this variant as a variant of concern (VOC).

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 S1 (RBD) Omicron B.1.1.529, BA.2, GFP/His-Tag