hACE2 Protein (ECD)

€590.00

Shipping calculated at checkout

trenzyme SKU: P2020-016_100

Only 5 left!

Variant: Tag-free liquid formulation
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

P2020-016: The human Angiotensin-Converting Enzyme 2 (hACE2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The hACE2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19. Our recombinant human ACE2 protein (ECD, processed) and tag-free has high quality and is excellent for SARS-CoV2 R&D.

--

P2020-024: The human Angiotensin-Converting Enzyme 2 (hACE2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The hACE2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19.

----

P2020-017: The human angiotensin-converting enzyme 2 (hACE2) has been shown to be the entry receptor for SARS-CoV-2 infection. Therefore, hACE2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19. Our high-quality biotinylated hACE2 protein (ECD) with Avi/His tag is ideal for SARS-CoV-2 research and development.

---

P2020-037: The hACE2 protein is among the most important components for coronavirus research to develop effective therapies for COVID-19, as it has been shown to be an entry receptor for SARS-CoV-2 infection hACE2 is highly expressed on tissue surfaces that have been shown to harbor SARS-CoV - these include the surface of cells of the human lung, arteries, kidneys, heart and intestine. Our non-biotinylated hACE Protein is made in Germany and shows high purity and quality.

trenzyme cellebrity kolben
  • Product Name: hACE2 Protein (ECD, processed), Tag-free, liquid formulation
    hACE2 Protein (ECD, processed), Tag-free, lyophilized formulation
    hACE2 Protein (ECD), Avi/His-Tag, biotinylated 
    hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated
  • Catalog No.: P2020-016, P2020-024, P2020-017, P2020-037
  • RefSeq Links: UniProt#: Q9BYF1
  • Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15; ---------biotinylated hACE2; non-biotinylated hACE2
  • Species: Homo sapiens
  • Tags: Tag-free / Tag-free /  Avi/His-Tag, C-terminal /  Avi/His-Tag, C-terminal, Avi-Tag not biotinylated
  • Sequence without tags for P2020-016 and P2020-024: (AA 20-708):

    MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
    LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
    QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
    YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
    IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
    GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
    IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
    LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
    DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
    RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
    KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
    ISFNFFVTAPKNVSDIIPRTEVEKAIRMSR
  • Sequence without tags for P2020-017: (AA 20-707):

    MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
    LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
    QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
    YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
    IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
    GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
    IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
    LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
    DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
    RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
    KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
    ISFNFFVTAPKNVSDIIPRTEVEKAIRMS
  • Sequence without tags for P2020-037: (AA 20-707):

    TIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
    LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
    QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
    YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
    IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
    GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
    IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
    LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
    DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
    RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
    KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
    ISFNFFVTAPKNVSDIIPRTEVEKAIRMS
  • Expression Host: HEK293
  • Formulation: 50 mM Tris, 250 mM NaCl, pH 8,0 / 50 mM Tris, 250 mM NaCl, pH 8,0 / PBS, pH 7,4 / PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C / Lyophilized and shipped at room temperature. / Liquid, stored and shipped at -80°C / Liquid, stored and shipped at -80°C
  • Purity: > 80% as determined by SDS-PAGE (P2020-024:) If maximum activity is needed, we recommend ordering our protein as liquid formulation:
  • Application: ELISA, WB, Functional Assay


The human Angiotensin-Converting Enzyme 2 (hACE2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, a regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension.

hACE2 is highly expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).

Additional information for P2020-016: hACE2(ECD) processed, Tag-free, liquid formulation

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of hACE2 Protein (ECD, processed), Tag-free, liquid formulation
Histogram of hACE2 Protein (ECD, processed), Tag-free, liquid formulation

SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry

Size exclusion chromotography (SEC)

 

hACE2 Biolayer Interferometry
Size exclusion chromotography (SEC) of hACE2 Protein (ECD, processed)

Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), Tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-Tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model.
Device: Octet RED96e, ForteBio.

Analytical size exclusion chromotography (SEC) of the purified protein indicates an at least dimeric running behavior (blue arrow).

 

Fluorescence chromatogram

Binding assay

Fluorescence chromatogram of hACE2 Protein (ECD, processed)
Binding assay of hACE2 Protein (ECD, processed) ELISA RBD tag-free binds ACE2

Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG).

RBD (tag-free) binds ACE2 (detected by monoclonal antibody CR3022).

Additional information for P2020-017: hACE2(ECD) biotinylated, Avi/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of hACE2(ECD) biotinylated
Histogram of hACE2(ECD) biotinylated

Additional information for P2020-037: hACE2(ECD) non-biotinylated, Avi/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated
Histogram of hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated

Download Product Information for P2020-016: hACE2(ECD) processed, Tag-free, liquid formulation

Download Product Information for P2020-017: hACE2(ECD) biotinylated, Avi/His-Tag

Download Product Information for P2020-024: hACE2(ECD) processed, Tag-free, lyophilized formulation

Download Product Information for P2020-037: hACE2(ECD) non-biotinylated, Avi/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.