SARS-CoV-2 (COVID-19) N-protein, delta N-term, His-Tag

€199.00 €420.00 Save €221

Shipping calculated at checkout

trenzyme SKU: P2020-058_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant SARS-CoV-2 (COVID-2019) Nucleoprotein (N-protein) from Wuhan pneumonia virus with N-terminal deletion and N-terminal His-Tag.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 N-Protein, delta N-term, His-Tag
  • Catalog No.: P2020-058
  • RefSeq Links: UniProt: P0DTC9
  • Synonyms: coronavirus NP Protein; 2019-nCoV; coronavirus Nucleocapsid Protein; coronavirus Nucleoprotein Protein; cov np Protein; ncov NP Protein; N Protein; NCP-CoV Nucleocapsid Protein; novel coronavirus NP Protein; novel coronavirus Nucleocapsid Protein; novel coronavirus Nucleoprotein Protein; np Protein; nucleocapsid Protein; Nucleoprotein Protein
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, N-terminal
  • Sequence without tags (AA 120-420):
    MGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRG
    GSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKG
    QQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDY

  • Expression Host: E. coli
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phosphoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, mainly in the N-termnal domain. Therefore, the N-terminal truncated variant is often preferred for diagnostic purposes to minimize false positive results.

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 N-Protein, delta N-term, His-Tag
Histogram (of marked lane in gel picture) of N-Protein, delta N-term,His-Tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us