SARS-CoV-2 S1 (RBD) Alpha, B.1.1.7 (U.K.), GFP/His-Tag
€420.00 €470.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-041 trenzyme
Description
Recombinant protein of the receptor binding domain (RBD), Mutant (N501Y) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The N501Y mutation is common for different of the currently observed fast spreading SARS-CoV-2 virus variants alpha, beta and gamma (B.1.1.7, B.1.351 and P1) that have emerged in recent months. The N501Y mutant is one of the most common and important mutations as it affects the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to this mutation, the virus is allowed to bind with higher affinity to human ACE2 receptor which results in approximately 80% higher transmissibility of the SARS-CoV-2 virus alpha variant (B.1.1.7 lineage).
Overview
-
Product Name: SARS-CoV-2 S1 (RBD) (N501Y), GFP/His-Tag
- Catalog No.: P2020-041
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
-
Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (N501Y); 501.V2; VUI-202012/01; B.1.1.7; B117; UK Variant; UK lineage; B.1.351; B1351; South Africa Variant; South African lineage; P.1; P1, Brazil Variant; Brazilian lineage; N501Y mutation of SARS-CoV-2 Spike
Customer Testimonial
“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
-
Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: GFP/His-Tag, C-terminal
-
Sequence without tags (AA 319-541):
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
QPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
X indicates mutation sites
Product Information
- Expression Host: human, HEK293
- Formulation: PBS, pH 7,4
- Format: Liquid, stored and shipped at -80 °C
- Purity: > 85% as determined by SDS-PAGE
Background Information
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 501Y.V2, also known as lineage B.1.1.7, exhibits several mutations. Compared to the previously circulating variants, the mutation N501Y of SARS-CoV-2 Spike S1 (RBD) results in a significant higher transmissibility. This increase is most likely due to a higher binding affinity of the spike protein to hACE2. Therefore, the N501Y mutation is considered the most dangerous modification of the virus.
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
