SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

€420.00 €470.00 Save €50

Shipping calculated at checkout

trenzyme SKU: P2020-033_100

Only 6 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (Y453F) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag. The Y453F mutation (also called Danish Mink mutation / Cluster 5 mutation (ΔFVI-spike)) was first discovered in Denmark and is located in a conservative region of the RBD directly involved in ACE2 binding. Thereby this mutation could have implications for viral fitness, transmissibility and antigenicity.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (Y453F))
  • Catalog No.: P2020-033
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (Y453F); Danish Mink mutation; Cluster 5 Mutation; ΔFVI spike
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
    DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLFRLFRKSNLKPFERDISTEIYQAG
    STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation site
  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 80% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A mutation first discovered in Denmark, called “Cluster 5”, also known as the ΔFVI-spike, is related to four genetic changes. This mutation (Y453F) is located in a conservative region of the RBD directly involved in ACE2 binding and thereby could have implications for viral fitness, transmissibility, and antigenicity.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark) SDS-Page
SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark) Histogram

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us