SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), GFP/His-Tag

€420.00 €470.00 Save €50

Shipping calculated at checkout

trenzyme SKU: P2020-049_100

Only 5 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (L452R-T478K) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag. The mutations L452R-T478K are characteristic for the fast spreading SARS-CoV-2 virus variants B.1.617 emerged in India. These mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor which results in increased transmissibility of the SARS-CoV-2 virus.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (L452R, T478K)), GFP/His-Tag
  • Catalog No.: P2020-049
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (L452R, T478K); 501.V2; VUI-202012/01; B.1.617; B1617; B.1.617.1; B16171; B.1.617.2; B16172; B.1.617.3; B16173; Indian Variant; ; E484Q; T478K
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFST
    FKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAW
    NSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSY
    GFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and T478K of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.


Binding of Delta spike RBD variant to the membrane of ACE2 overexpressing cells

 

5 minutes of labeling at different wild-type spike RBD concentrations

Binding of Delta spike RBD-GFP variant to wild-type HEK293 cells or those overexpressing ACE2 at different RBD concentrations (0.2, 1 and 5 µg/ml) after a labeling of 5 minutes.
Data provided by Kovacs T., Nagy P., Panyi G. and Zakany F., Department of Biophysics and Cell Biology, University of Debrecen, Hungary

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant L452R, T478K, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant L452R, T478K, GFP/His-Tag

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
27 February 2023 Veklury® (remdesivir) formulations inhibit initial membrane-coupled events of SARS-CoV-2 infection due to their sulfobutylether-β-cyclodextrin content Tamas Kovacs, Kitti Kurtan, Zoltan Varga, Peter Nagy, Gyorgy Panyi, Florina Zakany Despite its contradictory clinical performance, remdesivir (Veklury®) has a pivotal role in COVID-19 therapy. Possible contributions of the vehicle, sulfobutylether-β-cyclodextrin (SBECD) to Veklury® effects have been overlooked. The powder and ... read more https://doi.org/10.1111/bph.16063

 

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us