SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), GFP/His-Tag

• Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (L452R, E484Q)), GFP/His-Tag
  
• Catalog No.: P2020-046
• RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
• Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (E484Q, L452R); 501.V2; VUI-202012/01; B.1.617; B1617; B.1.617.1; B16171; B.1.617.2; B16172; B.1.617.3; B16173; Indian Variant; ; E484Q; L452R
  

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  
• Tags: GFP/His-tag, C-terminal
• Sequence without tags (AA 319-541):
  

  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFST
  FKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAW
  NSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVQGFNCYFPLQSYG
  FQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

  X indicates mutation sites
  

• Expression Host: human, HEK293
• Formulation: PBS, pH 7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 95% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and E484Q of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD, Mutant (L452R, E484Q)), GFP/His-Tag