SARS-CoV-2 S1 (RBD) Mu B.1.621 (Columbia), GFP/His-Tag

€420.00 €470.00 Save €50

Shipping calculated at checkout

trenzyme SKU: P2020-057_100

Only 1 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (R346K, E484K, N501Y) of SARS-CoV-2 (COVID-2019) spike S1 from Wuhan pneumonia virus with C-terminal GFP/His tag. The mutations R346K, E484K, and N501Y are identified in the SARS-CoV-2 virus variant B.1.621, which emerged in South America and was first reported in Colombia in January 2021. B.1.621 classified as Variant of Interest (VOI) and also known as Mu variant. The mutations are located in the RBD domain of SARS-CoV-2 and bind with high affinity to the human ACE2 receptor. The Colombian Mu variant initiates infection in the upper respiratory tract and is considered as the fastest spreading variant and one of the most dangerous.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 S1 (RBD) (R346K, E484K, N510Y), GFP/His-Tag (cleavable)
  • Catalog No.: P2020-057
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (R346K, E484K, N510Y); Mu; B.1.621; Columbian Variant; Columbia; R346K; E484K; N510Y
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATKFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGF
    QPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. There is strong evidence that this particular mutation increases the infectivity of SARS-CoV-2 and the ability of the host to evade the immune system. Of all the amino acid changes in the Colombian Mu variant, the E484K mutation was previously discovered in the Alpha (UK), Beta (South Africa), and Gamma (Brazil) lineages, and is thought to further enhance the ability to evade the immune system. The N501Y mutation site in this variant leads to an enhancement of viral transmission. Early studies showed that this new variant has lower susceptibility to convalescent plasma. In addition, the Mu variant contains the R346K mutation, which has been detected in dominant circulating variants of the virus responsible for COVID-19 disease. The Mu variant is classified as a "variant of interest" (VOI) by the World Health Organization (WHO).


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant R346K, E484K, N510Y, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant R346K, E484K, N510Y, GFP/His-Tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us