SARS-CoV-2 S1 (RBD) Omicron B.1.1.529, BA.1, GFP/His-Tag

€430.00 €470.00 Save €40

Shipping calculated at checkout

trenzyme SKU: P2020-061_100

Only 9 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-2019) spike S1 from Wuhan pneumonia virus, Omicron variant BA.1 with a high number of mutations (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H). Protein with C-terminal GFP/His tag.
The variant also known as PANGO lineage B.1.1.529 BA.1 has an unusually large number of mutations, several of which are novel and several of which affect the spike protein used for most vaccine targeting at the time of its discovery. This exceptional level of variation has led to concerns regarding transmissibility, immune system evasion, and vaccine resistance.
Therefore, the WHO designated it as a variant of concern. The GISAID project has assigned it the clade identifier GR/484A and the Nextstrain project has assigned it the clade identifier 21K.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 S1 (RBD) (Omicron Variant B.1.1.529 BA.1), GFP/His-tag (cleavable)
  • Catalog No.: P2020-061
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2; Genebank Accession: #QHD43416.1
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493K, G496S, Q498R, N501Y, Y505H); Omicron; B.1.1.529; South Africa; Botswana; GISAID clade: GISAID clade GR/484A; Nextstrain clade 21K; variant of concern (VOC)
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWN
    SNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYSF
    RPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 75% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. During the actual COVID-19 pandemic, several variants of the virus evolved and some of them are continuously spreading all over the world.
This SARS-CoV-2 variant assigned as "Omicron" by the World Health Organization (WHO) belongs to Pango lineage B.1.1.529. It is characterised by 30 changes, three small deletions and one small insertion in the spike protein, of these, 15 are in the receptor binding domain. Since the Omicron variant is the most divergent variant that has been detected in significant numbers during the pandemic so far, many concerns raised that it may be associated with increased transmissibility, significant reduction in vaccine effectiveness and increased risk for reinfections. Actually, researchers all over the world are looking with the highest priority into any potential impact the Omicron variant has on the effectiveness of COVID-19 vaccines. As of 26 November 2021, ECDC has classified this variant as a variant of concern (VOC).

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Omicron B.1.1.529, BA.1, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Omicron B.1.1.529, BA.1, GFP/His-Tag

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
27 February 2023 Veklury® (remdesivir) formulations inhibit initial membrane-coupled events of SARS-CoV-2 infection due to their sulfobutylether-β-cyclodextrin content Tamas Kovacs, Kitti Kurtan, Zoltan Varga, Peter Nagy, Gyorgy Panyi, Florina Zakany Despite its contradictory clinical performance, remdesivir (Veklury®) has a pivotal role in COVID-19 therapy. Possible contributions of the vehicle, sulfobutylether-β-cyclodextrin (SBECD) to Veklury® effects have been overlooked. The powder and ... read more https://doi.org/10.1111/bph.16063

 

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us