SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag

€430.00 €470.00 Save €40

Shipping calculated at checkout

trenzyme SKU: P2020-060_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (L452R-T478K) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag. The mutations L452R-T478K are characteristic for the fast spreading SARS-CoV-2 virus variants B.1.617 emerged in India. These mutations are affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutations, the virus is allowed to bind with higher affinity to human ACE2 receptor which results in increased transmissibility of the SARS-CoV-2 virus.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (L452R, T478K)), His-Tag
  • Catalog No.: P2020-060
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (L452R, T478K); 501.V2; VUI-202012/01; B.1.617; B1617; B.1.617.1; B16171; B.1.617.2; B16172; B.1.617.3; B16173; Indian Variant; Delta; E484Q; T478K
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGF
    QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 75% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and T478K of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant L452R, T478K, His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant L452R, T478K, His-Tag

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
13 June 2023 A novel ACE2 decoy for both neutralization of SARS-CoV-2 variants and killing of infected cells Alexandra Kegler, Laura Drewitz, Claudia Arndt, Cansu Daglar, Liliana Rodrigues Loureiro, et al. The coronavirus disease 2019 (COVID-19) pandemic caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) led to millions of infections and deaths worldwide. As this virus evolves rapidly, there is a high need for treatment options that can win the race against new emerging variants of concern. Here, we describe a novel immunotherapeutic drug based on the SARS-CoV-2 entry receptor ACE2 and provide experimental evidence... read more https://doi.org/10.3389/fimmu.2023.1204543

 

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us