SARS-CoV-2 (COVID 19) Spike S1 Protein (RBD), Tag-removed

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
• Tags: Tag-free; His-Tag removed by proteolytic digest
• Sequence without tags (AA 319-541):
  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
  DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
  STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  

• Expression Host: human, HEK293
• Formulation: PBS, pH 7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD), Tag removed