
SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), lyophilized formulation
€270.00 €300.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-021 trenzyme
Description
Recombinant protein of the receptor binding domain (RBD) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag, lyophilized formulation.
Overview
- Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), lyophilized formulation
- Catalog No.: P2020-021
- RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
- Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”
Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany
Sequence Information
- Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
- Tags: His-Tag, C-terminal
-
Sequence without tags (AA 319-541):
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Product Information
Background Information
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.