SARS-CoV-2 S1 (RBD) Alpha, B.1.1.7 (U.K.)

• Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (N501Y))
  
• Catalog No.: P2020-035
• RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
• Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (N501Y); 501.V2; VUI-202012/01; B.1.1.7; B117; U.K. Variant; U.K. lineage; B.1.351; B1351; South Africa Variant; South African lineage; P.1; P1, Brazil Variant; Brazilian lineage; N501Yviral-proteins mutation of SARS-CoV-2 Spike
  

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  
• Tags: His-Tag, C-terminal
• Sequence without tags (AA 319-541):
  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
  DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSkNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
  STPCNGVEGFNCYFPLQSYGFQPTNYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  
  X indicates mutation sites

• Expression Host: human, HEK293
• Formulation: PBS, pH  7,4
• Format: Liquid, stored and shipped at -80 °C
• Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 501Y.V2, also known as lineage B.1.1.7, exhibits several mutations. Compared to the previously circulating variants, the mutation N501Y of SARS-CoV-2 Spike S1 (RBD) results in a significant higher transmissibility. This increase is most likely due to a higher binding affinity of the spike protein to hACE2. Therefore, the N501Y mutation is considered the most dangerous modification of the virus.

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD, Mutant (N501Y))