Furin, GFP/His-tag

€990.00

Shipping calculated at checkout

trenzyme SKU: P2020-119_100

Only 1 left!

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant Furin protease containing a GFP/His-tag produced in mammalian cell system (HEK cells). The protease cleaves proteins just downstream of a basic amino acid target sequence thereby processing cellular precursor proteins and activating toxins like Anthrax or viral proteins like SARS-CoV-2 Spike protein.

trenzyme cellebrity kolben
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: Furin, GFP/His-Tag
  • Catalog No.: P2020-119
  • RefSeq Links: UniProt: P09958; NP_001276752.1; NM_001289823.1; NP_001276753.1; NM_001289824.1; NP_002560.1; NM_002569.3; PIR: A39552; GeneID: 5045
  • Synonyms: Furin (Paired Basic Amino Acid Cleaving Enzyme); PCSK3; PACE; FUR; SPC1; Paired Basic Amino Acid Residue-Cleaving Enzyme; EC 3.4.21.75; Paired Basic Amino Acid Cleaving Enzyme (Furin, Membrane Associated Receptor Protein); Proprotein Convertase Subtilisin/Kexin; EC 3.4.21
  • Species: Homo sapiens, human
  • Tags: GFP/His-Tag, C-terminal
  • Sequence without tags (AA 27-715):
    MQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHS
    RLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGH
    GIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAV
    ANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDG
    PARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGN
    VPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEAN
    KNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVA
    PQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHL
    VSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTK
    FTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDT
    HYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRES
    PPQQQPPRLPPEVEAGQRLRAGLLPSHLPE
  • Expression Host: human, HEK293
  • Formulation: PBS; pH 7.4.
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 85% as determined by SDS-PAGE

Furin, also known as paired basic Amino acid Cleaving Enzyme (PACE) is a ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg˅. However, the enzyme prefers the site Arg-X-Lys/Arg-Arg˅.
It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms.
Substrates of Furin include blood clotting factors, serum proteins and growth factor receptors such as the insulin-like growth factor receptor but also viral proteins like the SARS-CoV-2 Spike protein.
Furin is inhibited by EGTA, α1- Antitrypsin Portland and polyarginine compounds.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE of Furin, GFP/His-Tag
Histogram (of marked lane in gel picture) Furin, GFP/His-Tag

Download Product Information for Furin, GFP/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.