human Cadherin-17

€299.00

Shipping calculated at checkout

trenzyme SKU: P2020-178_100

Availability on request

Size: 100µg
Tag: MBP/His-Tag

Need a quote for an individual request or for a bulk order? Please contact us

Description

Cadherin-17 (CDH17), also known as liver-intestine cadherin (LI-cadherin), belongs to the cadherin superfamily of calcium-dependent cell adhesion molecules. It plays pivotal roles in various physiological processes, particularly in gastrointestinal epithelial integrity, liver development, and carcinogenesis. Therapeutically, CDH17 emerges as a potential target for the development of novel drugs, which aim to modulate cell adhesion and signaling pathways in gastrointestinal disorders and cancer.

trenzyme cellebrity kolben
  • Product Name: human Cadherin-17, MBP/His-Tag / human Cadherin-17, Fc/His-Tag / human Cadherin-17, His-Tag N-terminal / human Cadherin-17, His-Tag C-terminal
  • Catalog No.: P2020-178 / P2020-179 / P2020-180 / P2020-181
  • RefSeq Links: HGNC:1756; NX_Q12864; NP_001138135.1; NM_004063.3; PDBe 7cym; UniProt: Q12864
  • Synonyms: CDH17, Liver-intestine cadherin, LI-cadherin, Intestinal peptide-associated transporter HPT-1
  • Species: Homo sapiens
  • Tags: MBP/His-tag, N-terminal / Fc/His-tag, C-terminal / His-tag, N-terminal / His-tag, C-terminal
  • Sequence without tags (AA 23-787):
    MQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYN
    RALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQSKYEGSVRQNSRP
    GKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYFQINNKTGAISLTREGSQELNP
    AKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDPHPIKITQ
    VRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLS
    YPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIGTLTAHDRDEENTANSFLNYRI
    VEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNLTIEVSDKDFKTLCFVQINVID
    INDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEPFTGSSKILYHIIKGDSEGRLG
    VDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLVFGVKYNASSFAKFTLIVTDVN
    EAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFS
    VAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLFFCHPLS
    APGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYV
    VLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQTGIPTVGM
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: ELISA, Functional Assay

Cadherin-17 (CDH17), which is also referred to as liver-intestine cadherin (LI-cadherin), is a member of the cadherin superfamily of calcium-dependent cell adhesion molecules. In the gastrointestinal tract, CDH17 is predominantly expressed in the intestinal epithelium, contributing to cell-cell adhesion, and maintenance of epithelial integrity. CDH17-mediated adhesion plays a crucial role in regulating epithelial barrier function, mucosal repair, and protection against microbial invasion. Additionally, CDH17 is involved in the formation and maintenance of intestinal epithelial cell polarity, which is essential for proper absorption and secretion of nutrients and electrolytes. During liver organogenesis, hepatoblasts and bile duct epithelial cells express CDH17, which participates in cell-cell adhesion and tissue organization. In the adult liver, however, CDH17 expression is restricted to the bile duct epithelium, where it contributes to the structural integrity of bile ducts and regulates bile flow. Dysregulation of CDH17 expression or function is associated with gastrointestinal malignancies, including gastric cancer, colorectal cancer, and hepatocellular carcinoma. Overexpression of CDH17 in cancer cells promotes tumor cell proliferation, invasion, and metastasis by enhancing cell-cell adhesion, facilitating epithelial-mesenchymal transition, and modulating signaling pathways involved in tumor progression. CDH17 represents a promising therapeutic target in order to treat gastrointestinal disorders and malignancies. Nevertheless further research is required to elucidate the precise molecular mechanisms induced by CDH17 signaling pathways and to explore its therapeutic implications in various pathological conditions.

Additional information for human Cadherin-17, MBP/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for human Cadherin-17 MBP/His-Tag
Histogram for human Cadherin-17 MBP/His-Tag

Additional information for human Cadherin-17, Fc/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for human Cadherin-17 Fc/His-Tag
Histogram for human Cadherin-17 Fc/His-Tag

Additional information for human Cadherin-17, His-Tag N-terminal

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for human Cadherin-17 His-Tag N-terminal
Histogram for human Cadherin-17 His-Tag N-terminal

Additional information for human Cadherin-17, His-Tag C-terminal

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page for human Cadherin-17 His-Tag C-terminal
Histogram for human Cadherin-17 His-Tag C-terminal

Download Product Information for human Cadherin-17, MBP/His-Tag

Download Product Information for human Cadherin-17, Fc/His-Tag

Download Product Information for human Cadherin-17, His-Tag N-terminal

Download Product Information for human Cadherin-17, His-Tag C-terminal

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.