African swine fever virus (ASFV) Phosphoprotein p30

€590.00

Shipping calculated at checkout

trenzyme SKU: P2020-120_100

Available Now!

Size: 100µg
produced in: Mammalian

Need a quote for an individual request or for a bulk order? Please contact us

Description

In the natural host, the ASFV p30 protein (CP204L) is a 30-kDa phosphoprotein localized in the membrane and also secreted by cells. The relevant parts of this highly immunogenic protein have been produced using different expression systems, including E. coli and mammalian cells, and subsequently purified by chromatographic methods.

Please note: Illustration of protein structure only as example based on SwissModel of UniProt Q8V1E7, AA 137-193

trenzyme cellebrity kolben
  • Product Name: ASFV p30, GFP/His-tag
  • Catalog No.: P2020-113; P2020-120
  • RefSeq Links: B9UNA3
  • Synonyms: CP204L; Isolate: CN/2019/InnerMongolia-AES01; ASFV/Primorsky 19/WB-6723; ASFV Georgia 2007/1
  • Species: African swine fever virus (ASFV)
  • Tags: His-Tag, N-terminal and GFP, C-terminal / GFP/His-tag, C-terminal
  • Sequence without tags (AA 85-194):
    MILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKT     VQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK

  • Sequence without tags (AA 85-194): MILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK
  • Expression Host: E. coli / human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 75% as determined by SDS-PAGE / > 95% as determined by SDS-PAGE

The African swine fever virus (ASFV) is a large (approx. 200 nm) enveloped virus with an icosahedral capsid and two membranes at its inner and outer sides, belonging to the Asfarviridae family. It is the only known virus with a double-stranded DNA genome to be transmitted by arthropods. The virus causes a haemorrhagic fever with high mortality rates in domestic pigs, known as African swine fever (ASF). Some isolates can cause death of animals very quickly within a few days after infection. It persistently infects its natural hosts, like warthogs, bushpigs, and soft ticks of the genus Ornithodoros. These animals most likely act as a vector, showing no disease signs. ASFV does not cause disease in humans. The virus replicates in the cytoplasm of infected cells and mainly targets myeloid lineage cells, especially monocyte/macrophages and dendritic cells.
The outbreak of African swine fever virus has recently devastated the Chinese pork industry and resulted in over 300,000 pigs being culled. The virus is continuing to spread across Asia, with new outbreaks in South Korea, the Philippines, Vietnam, Laos, and Cambodia. Currently, no vaccine is available against ASFV. In the natural host, the ASVF p30 protein (CP204L) is a 30-kDa phosphoprotein localized in the membrane and also secreted by cells. The relevant parts of this very immunogenic protein is produced by E.coli as expression host and purified by chromatographic methods.

Additional information for ASFV p30, GFP/His-tag, E.coli

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of ASFV p30, GFP/His-Tag
Histogram (of marked lane in gel picture) of ASFV p30, GFP/His-tag

Additional information for ASFV p30, GFP/His-tag, Mammalian

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of ASFV_p30_GFP/His-Tag
Histogram (of marked lane in gel picture) of ASFV_p30_GFP/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.