B7-H3 Protein, Human

€320.00

Shipping calculated at checkout

trenzyme SKU: P2020-002_100

Availability on request
Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein containing the extracellular domain (ECD) of human CD276, Isoform 2 with C-terminal His-Tag.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: B7-H3 Protein, Human
  • Catalog No.: P2020-002
  • RefSeq Links: UniProt: Q5ZPR3-2
  • Synonyms: B7-H3 Protein, Human; B7H3 Protein, Human; B7RP-2 Protein; CD276
  • Species: Homo sapiens, human
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 29-245):
    MLEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNA
    SLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQG
    VPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
  • Expression Host: human, HEK293
  • Formulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-PAGE/Coll. Coomassie
Histogram of marked lane in gel picture

Download Product Information for B7-H3 Protein, Human

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Cartoon character wearing a lab coat and headset, pointing and giving a thumbs-up while presenting trenzymes friendly laboratory expert the chatbot named Zymi asks "How can I help you today?"

Do you need a quote for an individual request or a bulk order?

Contact Us