Fimbrial Protein (pilA), His-tag

• Product Name: Fimbrial Protein (pilA), His-tag
  
• Catalog No.: P2020-143 strain: PAK; P2020-145 strain: Pa110594
  
• RefSeq Links:
  PAK: PDBe 1dzo A; UniProt: P02973
  Pa110594: pdb3JZZ; UniProt: Q8KQ36
• Synonyms: PAK pilA, pilA, Pilin, fimbrial protein, type 4 fimbrial protein PilA, type IV fimbrial protein

• Species: Pseudomonas aerigunosa
• Tags: His-tag, N-terminal
• Sequence without tags - strain: PAK (AA 35-150):
  MALEGTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADAN
  KLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPK
  GCSR
  
• Sequence without tags - strain: Pa110594 (AA 34-178):
  MDPFTVRTRVSEGLVLAEPAKLMISTDGSASTADLTRATTTWNQQSNNLGASSKYVTSVL
  MDAGNTGVITITYVADQVGLPTAGNTLILSPYINDGNTRTALATAVAAGTRGTIDWACTS
  ASNATATAQGFTGMAAGSVPQEFAPAQCR
  

• Expression Host: E. coli
  
• Formulation: PBS; pH 7.4. 
• Format: Liquid, stored and shipped at -80 °C
• Purity: > 85% as determined by SDS-PAGE
  
• Application: Immunogen, vaccine development

Pathogenic bacteria, such as Pseudomonas aeruginosa, have developed a variety of virulence factors facilitating the infection process. A prominent virulence factor are pilins essentially required for attachment of the pathogen to the host cell and thus to initiate an infection. Pilins of P. aeruginosa are polymers of non-covalently associated pilA monomers that form a fiber with a diameter of six nm and a length of up to several micrometers. These fibers are polar and dynamic, retractable structures that are regarded as prototypes of type IV pili. Although each pilA monomer has a receptor binding site, only the monomers at the pilus tip have functional binding sites mediating adhesion. Binding occurs at glycosylated receptors that contain a β-D-GalNAc (1 → 4)-β-D-Gal moiety, such as the glycolipids asialo-GM1 and asialo-GM2. Strikingly, pilin fibers of different bacterial strains are sometimes highly divergent, but all strains still seem to bind a common receptor, asialo-GM1. Structural elucidation of pilin variants is essential for the development of effective vaccines that block adhesion of pathogens to host cells. Successful crystallization of the pilin monomer pilA from the P. aeruginosa strain Pa110594 as well as PAK was enabled by truncation of the hydrophobic N-terminus to increase solubility without hindering receptor binding capacities.

Additional information strain: PAK

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Additional information strain: Pa110594

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for Fimbrial Protein (pilA), His-tag - strain: PAK

Download Product Information for Fimbrial Protein (pilA), His-tag - strain: Pa110594