human B7-2/CD86

€270.00

Shipping calculated at checkout

trenzyme SKU: P2020-153_100

Only 14 left!

Size: 100µg
Tag: His-Tag

Need a quote for an individual request or for a bulk order? Please contact us

Description

B7-2, also known as cluster of differentiation 86 (CD86), is a cell surface glycoprotein expressed on antigen-presenting cells (APCs) and plays a crucial role in regulating adaptive immune responses. As co-stimulatory molecule, B7-2 binds to CD28 expressed on the surface of T cells and thereby, provides a second signal that is inevitable for T cell activation, proliferation and differentiation into effector and memory T cells. Inhibitory signals induced by interaction of B7-2 with the cytotoxic T lymphocyte antigen-4 (CTLA-4) limit initial T cell activation in secondary lymphoid organs in order to prevent excessive immune stimulation. Modulating the B7-2/CD28 and B7-2/CTLA-4 interactions can have significant effects on immune responses and thus, represents a promising strategy to treat various autoimmune diseases and cancer.

trenzyme cellebrity kolben
  • Product Name: human B7-2/CD86
  • Catalog No.: P2020-151: GFP/His-Tag, P2020-152: Fc/His-Tag, P2020-153: His-Tag
  • RefSeq Links: UniProt: P42081; HGNC:1705; NX_P42081; NP_787058.4; NM_175862.4; PDBe 8hxb
  • Synonyms: CD86, CD86 antigen, T-lymphocyte activation antigen CD86, B7-2, Activation B7-2 antigen, B70, BU63, CTLA-4 counter-receptor B7.2, FUN-1, CD28LG2, LAB72, MGC34413
  • Species: Homo sapiens
  • Tags:
    P2020-151: GFP/His-Tag
    P2020-152: Fc/His-Tag
    P2020-153: His-Tag
  • Sequence without tags (AA 26-247):
    MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMG
    RTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPI
    SNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLS
    VSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: ELISA, WB, Immunostaining, Functional assay

The cell surface glycoprotein B7-2, also known as cluster of differentiation 86 (CD86), belongs to the B7 family of co-stimulatory molecules, which are expressed on antigen-presenting cells (APCs), including dendritic cells, macrophages and B cells. Resting APCs express low levels of B7 molecules, but various stimuli, such as microbial products and cytokines produced during innate immune reactions against pathogens, induce an increased expression of B7 molecules in order to promote adaptive immune responses. This regulated expression ensures that T cells are activated only when needed. When T cells encounter antigens displayed by APCs, which is the first signal required for complete T cell activation, B7-2 interacts with CD28 providing a co-stimulatory signal, the second crucial signal. T cell activation leads to cytokine production and proliferation of T cells, as well as differentiation into effector and memory T cells. This interaction is counterbalanced by the cytotoxic T lymphocyte antigen-4 (CTLA-4), which is expressed on T cells after antigen recognition and has a higher affinity for B7-2 than CD28. CTLA-4 provides inhibitory signals leading to downregulation of immune responses. Dysregulation of B7-2 causes autoimmune diseases, inflammatory disorders and cancer. Therefore, therapeutic strategies targeting B7-2 or its interactions are being explored to dampen autoimmune diseases and to enhance anti-cancer immunity.


 Additional information B7-2/CD86 GFP/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human B7-2CD86 GFP/His-Tag
Histogram of human B7-2CD86 GFP/His-Tag


 Additional information B7-2/CD86 Fc/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human B7-2CD86 FC/His-Tag
Histogram of human B7-2CD86 FC/His-Tag


 Additional information B7-2/CD86 His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human B7-2CD86 His-Tag
Histogram of human B7-2CD86 His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.