human BCMA

€370.00

Shipping calculated at checkout

trenzyme SKU: P2020-147_100

Available Now!

Size: 100µg
Tag: GFP/His-Tag

Need a quote for an individual request or for a bulk order? Please contact us

Description

B cell maturation antigen (BCMA) is a transmembrane glycoprotein that is predominantly expressed by mature B lymphocytes and mediates B cell survival. However, aberrant expression of BCMA contributes to malignant plasma cell survival promoting malignancy in cancer diseases, including leukemia, lymphomas, and most prominently multiple myeloma. Consequently, BCMA has emerged as a promising therapeutic target for the development of novel treatments for multiple myeloma.

trenzyme cellebrity kolben
  • Product Name: human BCMA
  • Catalog No.: P2020-147
  • RefSeq Links: UniProt: Q02223 HGNC:11913; NX_Q02223; NP_001183.2; NP_001183.2NM_001192.2; PDBe 8hxq
  • Synonyms: TNFRSF17, Tumor necrosis factor receptor superfamily member 17, CD269, CD antigen CD269, BCM, BCMA, B-cell maturation protein
  • Species: Homo sapiens
  • Tags: GFP/His-tag, C-terminal 
  • Sequence without tags (AA 1-54):
    MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: ELISA, WB, Immunostaining, Functional assay

B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a transmembrane glycoprotein crucial for the survival and function of B lymphocytes, particularly plasma cells. Signaling via BCMA is induced by binding to its ligands, a B cell activating factor (BAFF) and a proliferation-inducing ligand (APRIL), both of which are essential for B cell survival, maturation, and differentiation. BCMA has gained significant attention in the context of hematologic malignancies, particularly multiple myeloma. Aberrant expression of BCMA on myeloma cells contributes to the survival and proliferation of these malignant plasma cells. Therefore, a variety of therapeutic approaches targeting BCMA, such as bispecific antibody constructs, antibody-drug conjugates (ADCs), and chimeric antigen receptor (CAR)-modified T cell therapy, have been developed and revealed promising results in preclinical and clinical studies. Despite the progress in BCMA-targeted therapies, challenges regarding resistance mechanisms and relapse need to be further addressed.


 Additional information for BCMA, GFP/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human BCMA GFP/His-Tag
Histogram of human BCMA GFP/His-Tag


Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.