human CD28

$287.00

Shipping calculated at checkout

trenzyme SKU: P2020-154_100

Only 7 left!

Size: 100µg
Tag: Fc/His-Tag

Need a quote for an individual request or for a bulk order? Please contact us

Description

Cluster of differentiation 28 (CD28) is a crucial receptor expressed on the surface of T cells and plays a pivotal role in the regulation of the immune system. The engagement of CD28 with its ligands expressed on antigen-presenting cells (APCs) provides a co-stimulatory signal that is essential for T cell activation, proliferation and production of interleukin-2 (IL-2). Moreover, CD28 activation contributes to the development of memory T cells, which confer sustained immunity. Dysregulation of CD28 results in various autoimmune diseases, while its modulation holds therapeutic promise, especially in cancer immunotherapy.

trenzyme cellebrity kolben
  • Product Name: human CD28
  • Catalog No.: P2020-154: Fc/His-Tag
    P2020-155: GFP/His-Tag
  • RefSeq Links: HGNC:1653; NX_P10747; NP_006130.1; NM_006139.3; PDBe 1yjd; UniProt: P10747
  • Synonyms: CD28 antigen, T-cell-specific surface glycoprotein CD28, TP44
  • Species: Homo sapiens
  • Tags:
    P2020-154: Fc/His-Tag
    P2020-155: GFP/His-Tag
  • Sequence without tags (AA 19-152):
    MNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQ
    VYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKH
    LCPSPLFPGPSKP
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: ELISA, WB, Immunostaining, Functional assay

Cluster of differentiation 28 (CD28) is a member of the immunoglobulin superfamily representing a type I transmembrane glycoprotein and is constitutively expressed on the surface of more than 80 % CD4+ T cells and 50 % CD8+ T cells in humans, whereas in mice, all naïve T cells express CD28. As co-stimulatory receptor, CD28 interacts with its ligands, CD80 (B7-1) and CD86 (B7-2), which are expressed on antigen-presenting cells (APCs), such as dendritic cells, macrophages and B cells. This interaction provides a second signal, next to antigen recognition, that is inevitable for T cell activation and proliferation and consequently, for the initiation of effective adaptive immune responses. Engagement of CD28 induces intracellular signaling pathways leading to the activation of transcription factors and the expression of genes, which are involved in T cell activation, proliferation, and cytokine production. Particularly, CD28 signaling promotes the production of interleukin-2 (IL-2), a cytokine that is crucial for T cell proliferation, differentiation and survival. Furthermore, CD28 activation is involved in the generation of memory T cells, which contribute to sustained immunity. Aberrant CD28 signaling leads to autoimmune diseases, including rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. Therapeutically, CD28 holds promise as target for immunomodulatory strategies, such as blocking CD28 co-stimulation in order to suppress excessive immune responses, which occur in autoimmune diseases and transplant rejection. Additionally, modulation of CD28 signaling is explored to enhance anti-tumor immune responses.


 Additional information CD28 Fc/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human CD28 Fc/His-Tag
Histogram of human CD28 Fc/His-Tag


 Additional information CD28 GFP/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human CD28 GFP/His-Tag
Histogram of human CD28 GFP/His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.