human IL-10

€99.00

Shipping calculated at checkout

trenzyme SKU: P2020-146_10

Only 6 left!
Tag: Tag-free
Size: 10µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

The anti-inflammatory cytokine interleukin-10 (IL-10) plays a crucial role in regulating innate and adaptive immune responses in order to prevent chronic inflammation and tissue damage. IL-10 is produced by a variety of different cell types, including macrophages, dendritic cells (DCs), effector T lymphocytes, regulatory B cells and epithelial cells. Expression of IL-10 is tightly controlled to ensure efficient eradication of pathogens while reducing pathologic inflammation. Moreover, IL-10 is associated with autoimmune diseases, including multiple sclerosis and systemic lupus erythematosus, as well as several types of cancer.

human IL-10 is available with His-tag or Tag-free. The tag and size can be selected by using the buttons.

trenzyme cellebrity kolben
Overview
 Sequence Information Product Information Background Information Download
  • Product Name: human IL-10
  • Catalog No.: P2020-146
  • RefSeq Links: HGNC:5962; NX_P22301; NP_000563.1; NM_000572.2; PDBe 2ilk; UniProt: P22301
  • Synonyms: Interleukin 10, IL-10, IL10, Cytokine synthesis inhibitory factor (CSIF), CSIF Protein, TGIF Protein, GVHDS
  • Species: Homo sapiens
  • Tags: Tag-free; His-tag removed by proteolytic digest
  • Sequence without tags (AA 19-178):
    MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGY
    LGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSK
    AVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 90% as determined by SDS-PAGE
  • Application: ELISA, WB, Functional assay

Interleukin-10 (IL-10) is a cytokine that plays a crucial role in the regulation of both innate and adaptive immune responses and controls inflammatory processes. It was first identified in the early 1990s and has since been extensively studied for its immunoregulatory functions. IL-10 is produced by various immune cells, including effector T cells, B cells, classically and especially alternatively activated macrophages, dendritic cells (DCs), as well as certain non-immune cells.

IL-10 is often referred to as an "anti-inflammatory cytokine" because of its ability to suppress inflammation. It inhibits the production of pro-inflammatory cytokines like interleukin-1 (IL-1), interleukin-6 (IL-6), interleukin-12 (IL-12) and tumor necrosis factor-alpha (TNF-α). Moreover, IL-10 suppresses expression of MHC class II and costimulatory molecules B7-1/B7-2 on monocytes and macrophages, thereby impeding T cell activation and differentiation in the lymph nodes.
IL-10 is both produced by macrophages and DCs and inhibits their function by suppressing production of inflammatory cytokines indicating a sophisticated negative feedback mechanism that limits potential damage to tissues.

The non-covalently associated homodimer IL-10 binds to the type II cytokine receptor IL-10 consisting of two IL-10 R alpha chains. Binding results in the recruitment of two IL-10 R beta chains, which are essential for signal transduction. Signaling induces activation of Janus Kinase 1 (JAK1), Tyrosine Kinase 2 (TYK2), and the transcription factor STAT3.

Dysregulation of IL-10 is implicated in various diseases. For example, deficient IL-10 production or function is associated with inflammatory bowel diseases (IBD) like Crohn's disease and ulcerative colitis. Conversely, excessive IL-10 production can contribute to immune evasion by certain pathogens and promote the survival of cancer cells by suppressing anti-tumor immune responses.

Noteworthy, while human IL-10 is able to activate also murine cells, murine IL-10 is inactive on human cells.

 

Additional information human IL-10, Tag-free:

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture
SDS-Page of human IL10 Tag-free
Histogram of human IL10 Tag-free

 

Download Product Information for human IL-10, Tag-free

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.