human PD-L1, His-Tag

$379.00

Shipping calculated at checkout

trenzyme SKU: P2020-164_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Programmed death ligand 1 (PD-L1) is considered as crucial immune checkpoint regulator with significant implications in cancer and autoimmune diseases. Binding to its receptor, programmed cell death protein 1 (PD-1), provides inhibitory signals that modulate T cell activation and ensure maintenance of peripheral tolerance. Cancer cells often exploit the PD-L1/PD-1 pathway to evade immune surveillance. Overexpression of PD-L1 allows cancer cells to inhibit anti-tumor immune responses, leading to immune escape and tumor progression. PD-L1 expression in the tumor microenvironment has become a critical biomarker for predicting responses to immunotherapy.

trenzyme cellebrity kolben
  • Product Name: human PD-L1, His-Tag
  • Catalog No.: P2020-164
  • RefSeq Links: HGNC:17635; NX_Q9NZQ7; NP_054862.1; NM_014143.3; PDBe 7xae; UniProt: Q9NZQ7
  • Synonyms: Programmed cell death 1 ligand 1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
  • Species: Homo sapiens
  • Tags: His-tag, C-terminal
  • Sequence without tags (AA 19-239):
    MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ
    HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKI
    NQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTL
    RINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERT
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 95 % as determined by SDS-PAGE
  • Application: ELISA, WB, Functional assay

Programmed death ligand 1 (PD-L1), also known as B7 homolog 1 (B7-H1), is a transmembrane glycoprotein, which belongs to the B7 family of immune molecules and plays a pivotal role in regulating adaptive immune responses. Various stimuli, including inflammatory signals and interferon-gamma (IFN-ɣ), induce the expression of PD-L1 on antigen-presenting cells (APCs), such as dendritic cells, macrophages and B cells in peripheral tissues, as well as on epithelial and vascular endothelial cells. Its receptor, programmed cell death protein 1 (PD-1), which is expressed on activated T cells, recognizes PD-L1. This interaction serves as negative feedback mechanism to modulate T cell activation and to prevent excessive immune responses, contributing to immune homeostasis. Apparently, dysregulation of PD-L1 expression or function leads to the development of autoimmune diseases, such as rheumatoid arthritis. Tumor cells evade immune surveillance due to overexpression of PD-L1 on various cancer cell types. This enables inhibition of anti-tumor immune responses and promotes tumor growth and progression. PD-L1 expression in the tumor microenvironment has become a critical biomarker for predicting responses to immunotherapy. Immune checkpoint inhibition using monoclonal antibodies blocking the PD-1/PD-L1 interaction has emerged as excellent therapeutic strategy in cancer therapy. Further insights into PD-L1 biology will likely lead to improved treatment modalities and expanded applications in the field of immune-mediated diseases.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-Page of human PD-L1, His-Tag
Histogram of human PD-L1, His-Tag

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.