Influenza A – G4 EA H1N1 Haemagglutinin Protein – HA1 Subunit

$1,049.00

Shipping calculated at checkout

trenzyme SKU: P2020-100_100

Only 5 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

The HA1 Subunit of Haemagglutinin Protein (HA) from the Influenza A – G4 (EA) H1N1 virus plays a major role in the infection of a cell and is therefore a very important target for the development of antibody tests or for vaccine development. The HA1 domain binds to the cell surface receptor and thus brings virus particle into it. The HA1 protein belongs to the Class I viral fusion proteins and plays an important role in the determination of host range restriction and virulence. The protein is responsible for the penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane.

trenzyme cellebrity kolben
  • Product Name: G4 EA H1N1_HA1_His-Tag
  • Catalog No.: P2020-100
  • RefSeq Links: QEJ81106.1
  • Synonyms: H1N1; HA1; Hemagglutinin of Influenza A; swine flue; swine influenza
  • Species: H1N1
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 18-345):
    DTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENSHNGKLCSLNGKIPLQLGNCNVAGW
    ILGNPKCDLLLTANSWSYIIETSNSKNGACYPGEFADYEELKEQLSTVSSFERFEIFPKA
    TSWPNHDTTRGTTVACSHSGANSFYRNLLWIVKKGNSYPKLSKSYTNNKGKEVLVIWGVH
    HPPTDSDQQTLYQNNHTYVSVGSSKYYKRFTPEIVARPKVREQAGRMNYYWTLLDQGDTI
    TFEATGNLIAPWHAFALKKGSSSGIMRSDAQVHNCTTKCQTPHGALKGNLPFQNVHPVTI
    GKCPKYVKSTQLRMATGLRNIPSIQSRG
  • Expression Host: human, HEK293
  • ormulation: PBS, pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 85% as determined by SDS-PAGE

Recently, a prevalent Eurasian avian-like H1N1 swine influenza virus with a potential pandemic concern was described in the journal Proceedings of the National Academy of Science (PNAS). The described genotype 4 (G4) reassortant Eurasian avian-like (EA) H1N1 virus was found in Chinese pigs and has become predominant since 2016. According to the report (Sun et al., 2020, PNAS), similar to the pandemic 2009 H1N1 virus, G4 viruses bind to human-type receptors and therefore have the correct characteristics to cause human infections. The G4 EA H1N1 viruses have the ability to grow well in human lung cells and show efficient infectivity and aerosol transmission in ferrets. In their study (Sun et al., 2020, PNAS), the researchers were able to show that approximately 10% of swine workers (n=338) and 4% of 230 people from the general population in China were seropositive for the G4 EA H1N1 virus. This indicated that the virus has acquired increased human infectivity and therefore greatly enhanced the possibility of virus adaptation in humans. Experts believe, that pre-existing population immunity does not provide protection against G4 viruses. Moreover, according to scientists, the G4 viruses are diverse enough that seasonal flu vaccines would unlikely provide protection or prevent a human-to-human transmission.

Until now, there have been no reports of G4 viruses spreading from human to human – a characteristic that is required for classification as a pandemic. Nevertheless, controlling the prevalent G4 EA H1N1 virus in pigs and monitoring the swine worker populations are very important. Indeed, systematic surveillance of influenza viruses in pigs is a key measure for early warning and preparing for the next potential pandemic, as was demonstrated by the emergence of the 2009 pandemic. Therefore, it is very important to be prepared and to develop antibody tests or vaccines, for detecting a potential G4 EA H1N1 virus outbreak in humans and to have the right medicine ready.​


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

Influenza A – G4 EA H1N1 Haemagglutinin Protein – HA1 Subunit SDS-Page
Influenza A – G4 EA H1N1 Haemagglutinin Protein – HA1 Subunit Histogram

The table below lists publications that mention this catalog protein. To sort the table, click on the first row.
Have you cited this product in a publication? Let us know so we can reference it here.


Citation Date Citation Title Citation Authors Citation Abstract Citation DOI
15 September 2021 Ultra-sensitive and fast optical detection of the spike protein of the SARS-CoV-2 using AgNPs/SiNWs nanohybrid based sensors Kais Daoudi, Krithikadevi Ramachandran, Hussain Alawadhi, Rabah Boukherroub, Elhadj Dogheche, et al. Severe acute respiratory syndrome SARS-CoV-2 virus led to notable challenges amongst researchers in view of development of new and fast detecting techniques. In this regard, surface-enhanced Raman spectroscopy (SERS) technique, providing a fingerprint characteristic for each material, would be an interesting approach. The current study encompasses ... read more https://doi.org/10.1016/j.surfin.2021.101454

 

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.