Interleukin-13 receptor subunit alpha-1, His-tag

€310.00

Shipping calculated at checkout

trenzyme SKU: P2020-133_100

Available Now!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Interleukin 13 Receptor alpha 1 (IL13RA1) is part of the interleukin 13 (IL-13) receptor complex expressed on the surface of various cells, including immune cells, epithelial cells, and fibroblasts. Cytokine induced signaling via IL13RA1 promotes T helper 2 (Th2) mediated immunes responses, including eradication of helminths, regulation of inflammation as well as tissue remodeling and repair. Furthermore, IL13RA1 is associated with a variety of inflammatory diseases and cancer types.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: Interleukin-13 receptor subunit alpha-1, His-tag
  • Catalog No.: P2020-133
  • RefSeq Links: NP_001551.1; NM_001560.2; pdb5e4e; UniProt: P78552
  • Synonyms: IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL-13R-alpha-1; IL-13RA1; IL13RA1; IL-13Ra Protein; CD213A1 Protein; Cancer/testis antigen 19; CT19
  • Species: Homo sapiens, human
  • Tags: His-tag, C-terminal
  • Sequence without tags (AA 22-343):
    MGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIA
    PETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMK
    CSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQI
    MVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVN
    NSQTETHNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKL
    WSNWSQEMSIGKKRNST
  • Expression Host: HEK293
  • Formulation: PBS; pH 7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Interleukin 13 Receptor alpha 1 (IL13RA1) is part of the interleukin 13 (IL-13) receptor complex expressed on the surface of various cells, including B cells, mononuclear phagocytes, dendritic cells, eosinophils, basophils, bronchial epithelial cells, and fibroblasts. The IL-13 receptor complex is composed of IL13RA1 and the IL-4 receptor alpha chain (IL4RA) and can bind both cytokines IL-4 and IL-13 with high affinity. Binding of IL-13 to IL13RA1 leads to activation of tyrosine kinase 2 (TYK2) and janus kinase 2 (JAK2), which phosphorylate the signal transducer and activator transcription 6 (STAT6), thereby inducing transcription of IL-13 responsive genes. IL-13 plays a crucial role in host defense against helminths and is involved in alternative macrophage activation to regulate inflammatory processes and to promote tissue repair and fibrosis. Moreover, IL-13 is associated with inflammatory diseases, such as asthma and allergic rhinitis, and promotes tumor cell proliferation and metastasis. It has been shown that expression of IL13RA1 is increased in inflammatory diseases and several types of cancer. Therefore, IL13RA1 represents a promising therapeutic target.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

IL13Ra1 His-tag sds page
IL13Ra1 His-tag histogram

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us