Lanmodulin (LanM)

$706.00

Shipping calculated at checkout

trenzyme SKU: P2020-126_50

Only 1 left!

Size: 50µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Lanmodulin (LanM) is a bacterial protein exhibiting metal-binding properties. It binds rare-earth elements (REEs) with very high affinity.

trenzyme cellebrity kolben
  • Product Name: LanM
  • Catalog No.: P2020-126
  • RefSeq Links: UniProt: B1ZIE8; WP_003601797.1; PDB: 6MI5_X
  • Synonyms: Lanmodulin; Lanthanides; Lns
  • Species: Methylorubrum extorquens
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 1-133):

    MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDP
    DKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDAREL
    ASPAGSALVNLIR

  • Expression Host: E. coli
  • Formulation: PBS; pH 7.4.
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

Lanthanides (Lns) are essential cofactors in certain enzymes. Lanmodulin (LanM) is a metal binding protein found in several lanthanide-utilizing, methylotrophic bacteria like Methylorubrum sp. The protein exhibits unique metal-binding properties and binds rare-earth elements (REEs) with very high affinity, often better than many synthetic chelators. LanM-REE complexes are stable at extreme conditions like high temperature, repeated acid treatments down to pH 2.5 and up to molar amounts of competing non-REE metal ions.
Therefore, lanmodulin could be used even in harsh chemical processes for selective recovery of a broad range of REE from precumbustion coal and electronic waste leachates.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of lanM
Histogram (of marked lane in gel picture) of lanM

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.