Mouse Serum Albumin, His-Tag

$226.00

Shipping calculated at checkout

trenzyme SKU: P2020-169_100

Availability on request

Size: 100 µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Mouse serum albumin (MSA) is the most abundant protein in the blood plasma and plays pivotal roles in various physiological processes, including maintenance of osmotic pressure, transporting molecules, buffering pH, and modulating colloidal pressure. MSA serves as a valuable tool in biomedical research, used as a standard reference for various assays and experiments, including protein binding studies, drug delivery systems, and diagnostic assays.

We also offer Human Serum Albumin (HSA) - order it now!

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: Mouse Serum Albumin, His-Tag
  • Catalog No.: P2020-169
  • RefSeq Links: MGI:87991; HostDB:ENSMUSG00000029368; NP_033784.2; NM_009654.4; UniProt: P07724
  • Synonyms: Albumin, Alb, Serum albumin, MSA
  • Species: Mus musculus
  • Tags: His-tag, C-terminal
  • Sequence without tags (AA 19-608):
    MRGVFRREAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTC
    VADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNECFLQHKDDNPSLP
    PFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCAEAD
    KESCLTPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITK
    LATDLTKVNKECCHGDLLECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEV
    EHDTMPADLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKY
    EATLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQ
    KAPQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHV
    TKCCSGSLVERRPCFSALTVDETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELV
    KHKPKATAEQLKTVMDDFAQFLDTCCKAADKDTCFSTEGPNLVTRCKDALA
  • Expression Host: HEK293
  • Formulation: PBS; pH 7.4
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 90 % as determined by SDS-PAGE
  • Application: ELISA, WB

Mouse serum albumin (MSA) is a ubiquitous protein of the blood plasma in mice, constituting approximately half of the total protein content. Due to its exceptional ligand-binding capacity, MSA serves as multifunctional carrier protein, transporting various endogenous and exogenous ligands, including fatty acids, bilirubin, hormones, metal ions, and drugs. Its ability to bind these ligands with high affinity and specificity facilitates their distribution, metabolism, and elimination within the body. Additionally, MSA acts as scavenger of reactive oxygen species (ROS), thereby preventing oxidative damage to cells and tissues. Furthermore, MSA essentially contributes to the regulation of oncotic pressure to ensure fluid balance between the intravascular and interstitial compartments and to prevent edema. Alterations in MSA levels or function are associated with a range of clinical conditions, such as liver disease, kidney dysfunction, malnutrition, and inflammation. In biomedical research, MSA serves as a valuable tool, used as a standard reference for various assays and experiments, including protein binding studies, drug delivery systems, and diagnostic assays.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

Mouse Serum Albumin His-Tag SDS-Page
Mouse Serum Albumin His-Tag Histogram

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us