Pyrophosphatase, Inorganic

$359.00

Shipping calculated at checkout

trenzyme SKU: P2020-175_100

Only 7 left!

Size: 100µg
Tag: His-Tag

Need a quote for an individual request or for a bulk order? Please contact us

Description

Inorganic pyrophosphatase (PPase) is a crucial enzyme involved in cellular metabolism, specifically in the hydrolysis of inorganic pyrophosphate (PPi) into two orthophosphate (Pi) molecules. This reaction is essential for various biological processes, including nucleotide biosynthesis, energy metabolism, and maintaining phosphate homeostasis.

trenzyme cellebrity kolben
  • Product Name: Pyrophosphatase, Inorganic, MBP/His-Tag / Pyrophosphatase, Inorganic, His-Tag 
  • Catalog No.: P2020-174 / P2020-175
  • RefSeq Links: NP_418647.1; NC_000913.3; WP_000055075.1; NZ_SSUV01000014.1; PDBe 4um4; UniProt: P0A7A9
  • Synonyms: Pyrophosphate phospho-hydrolase, PPase
  • Species: E. coli
  • Tags: MBP/His-tag, N-terminal / His-tag, N-terminal
  • Sequence without tags (AA 1-176):
    MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYIN
    HTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDH
    IKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
  • Expression Host: E. coli
  • Formulation: 20 mM Tris, 100 mM NaCl, 1 mM DTT, 0.1 mM EDTA, 10 % Glycerol; pH 8.0
  • Format: Liquid, stored and shipped at -80° C
  • Purity: > 85 % as determined by SDS-PAGE / > 80 % as determined by SDS-PAGE
  • Application: in vitro transcription

Inorganic pyrophosphatase (PPase) is a ubiquitous enzyme found in all living organisms, from bacteria to humans. It plays a central role in cellular metabolism by catalyzing the hydrolysis of inorganic pyrophosphate (PPi), a byproduct of numerous biochemical reactions, into two molecules of orthophosphate (Pi). This enzymatic reaction is thermodynamically favorable and helps drive various biosynthetic pathways by preventing the accumulation of PPi, which can inhibit essential metabolic processes. The catalytic mechanism of inorganic pyrophosphatase involves a two-step hydrolysis reaction. In the first step, a metal ion within the active site coordinates with the pyrophosphate substrate, facilitating the nucleophilic attack by a water molecule. This results in the formation of a phosphorylated enzyme intermediate. In the second step, a second water molecule hydrolyzes this intermediate, leading to the release of two molecules of orthophosphate. The metal ion cofactor plays a crucial role in stabilizing the transition state and enhancing the efficiency of the catalytic reaction. Inorganic pyrophosphatase activity is regulated at multiple levels to maintain cellular homeostasis. Expression of the enzyme is tightly regulated in response to metabolic demands and environmental stimuli. Additionally, post-translational modifications, allosteric regulation, and interactions with other proteins can modulate its activity. Next to its role in nucleotide biosynthesis, inorganic pyrophosphatase participates in energy metabolism pathways such as glycolysis and oxidative phosphorylation. By catalyzing the hydrolysis of PPi, inorganic pyrophosphatase helps maintain the balance of phosphate ions within cells, which is crucial for DNA replication, RNA transcription, and protein synthesis.

Additional information for Pyrophosphatase Inorganic MBP/His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS Page for Pyrophosphatase Inorganic MBP His-Tag
Histogram for Pyrophosphatase Inorganic MBP His-Tag

Additional information for Pyrophosphatase Inorganic His-Tag

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS Page for Pyrophosphatase Inorganic His-Tag
Histogram for Pyrophosphatase Inorganic His-Tag

Download Product Information for Pyrophosphatase, Inorganic, MBP/His-Tag

Download Product Information for Pyrophosphatase, Inorganic, His-Tag 

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.