SARS-CoV-2 S1 (RBD) Alpha, B.1.1.7 (U.K.)

€420.00 €470.00 Save €50

Shipping calculated at checkout

trenzyme SKU: P2020-035_100

Only 1 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (N501Y) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag. The N501Y mutation is common for different of the currently observed fast spreading SARS-CoV-2 virus variants alpha, beta and gamma (B.1.1.7, B.1.351 and P1) that have emerged in recent months. The N501Y mutant is one of the most common and important mutations as it affects the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to this mutation, the virus is allowed to bind with higher affinity to human ACE2 receptor which results in approximately 80% higher transmissibility of the SARS-CoV-2 virus alpha variant (B.1.1.7 lineage).

trenzyme cellebrity kolben
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (N501Y))
  • Catalog No.: P2020-035
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (N501Y); 501.V2; VUI-202012/01; B.1.1.7; B117; U.K. Variant; U.K. lineage; B.1.351; B1351; South Africa Variant; South African lineage; P.1; P1, Brazil Variant; Brazilian lineage; N501Yviral-proteins mutation of SARS-CoV-2 Spike
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
    DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSkNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
    STPCNGVEGFNCYFPLQSYGFQPTNYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites
  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called 501Y.V2, also known as lineage B.1.1.7, exhibits several mutations. Compared to the previously circulating variants, the mutation N501Y of SARS-CoV-2 Spike S1 (RBD) results in a significant higher transmissibility. This increase is most likely due to a higher binding affinity of the spike protein to hACE2. Therefore, the N501Y mutation is considered the most dangerous modification of the virus.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SARS-CoV-2 S1 (RBD) Alpha, B.1.1.7 (U.K.) SDS-Page

 

SARS-CoV-2 S1 (RBD) Alpha, B.1.1.7 (U.K.) Histogram

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.