SARS-CoV-2 S1 (RBD) B.1.141/B.1.258 (Scotland/U.K.)

€420.00 €470.00

Price excl. shipping costs excl. VAT. For more information, see our shipping policy

SKU: P2020-034 trenzyme

Need a quote for an individual request or for a bulk order?

Please contact us.

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (N439K) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal His-Tag. The N439K mutation, lineage B.1.141/B.1.258 (Scotland/UK), is known as the second common mutation in the RBD of SARS-CoV-2 and binds with high affinity to human ACE2 receptor. The mutation may result in immune escape from a panel of neutralizing monoclonal antibodies and polyclonal sera of persons recovered from infection.

Overview

  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (N439K))
  • Catalog No.: P2020-034
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (N439K); B.1.141; B1141; Scottish Variant; Scottish lineage; B.1.258; B1258; U.K. Variant; U.K. lineage
Cellebrity Kolben Cell Cartoon trenzyme

Customer Testimonial

“In our COVID-19 projects, we have had very good experience with the SARS-CoV-2 proteins produced by trenzyme: rapid and reliable production of the functional proteins from different cell lines continued to provide first-class support for our projects.”


Dr. Peter Rauch
CANDOR Bioscience GmbH, Wangen, Germany

Sequence Information

  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: His-Tag, C-terminal
  • Sequence without tags (AA 319-541):
    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA
    DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSKNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG
    STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation site

Product Information

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80 °C
  • Purity: > 70% as determined by SDS-PAGE

Background Information

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. The N439K mutation is known as the second most common mutation in the receptor binding domain and results in increased ACE2 affinity. This mutation seems to have no impact on the clinical spectrum of disease with slightly higher viral loads in vivo. However, the N439K mutants bind to the human ACE2 receptor with two-fold greater affinity and are may be resistant to some neutralising monoclonal antibodies that are used in treatments against COVID-19.


SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant N439K Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant N439K

Get in contact with us


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.