SARS-CoV-2 S1 (RBD) B.1.141/B.1.258 (Scotland/U.K.), GFP/His-Tag

• Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  
• Tags: GFP/His-Tag, C-terminal
• Sequence without tags (AA 319-541):
  MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
  KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
  SKNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
  QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  
  X indicates mutation sites
  

• Expression Host: human, HEK293
• Formulation: PBS, pH  7,4
• Format: Liquid, stored and shipped at -80°C
• Purity: > 85% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. The N439K mutation is known as the second most common mutation in the receptor binding domain and results in increased ACE2 affinity. This mutation seems to have no impact on the clinical spectrum of disease with slightly higher viral loads in vivo. However, the N439K mutants bind to the human ACE2 receptor with two-fold greater affinity and are may be resistant to some neutralising monoclonal antibodies that are used in treatments against COVID-19. 

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Download Product Information for SARS-CoV-2 Spike S1 Protein (RBD, Mutant (N439K)), GFP/His-Tag