SARS-CoV-2 S1 (RBD) Epsilon, B.1.427/B.1.429 (California/USA), GFP/His-Tag

€420.00 €470.00 Save €50

Shipping calculated at checkout

trenzyme SKU: P2020-048_100

Only 9 left!

Size: 100µg

Need a quote for an individual request or for a bulk order? Please contact us

Description

Recombinant protein of the receptor binding domain (RBD), Mutant (L452R) of SARS-CoV-2 (COVID-2019) Spike S1 from Wuhan pneumonia virus with C-terminal GFP/His-Tag. The mutation L452R is characteristic for the SARS-CoV-2 virus variants B.1.427 or B.1.429 emerged in California/USA. These variants are also known as CAL.20C. The mutation is affecting the receptor binding domain (RBD) of the spike protein, which the virus uses to bind to human cells receptors and enter them. Due to the mutation, the virus is allowed to bind with higher affinity to human ACE2 receptor, which results in increased transmissibility of the SARS-CoV-2 virus.

Cartoon laboratory scientist Jelly the Cellebrity in a white lab coat holding a flask with liquid and pointing upward
  • Product Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD, Mutant (L452R)), GFP/His-Tag
  • Catalog No.: P2020-048
  • RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
  • Synonyms: SARS-CoV-2; coronavirus; SARS-CoV-2 spike RBD; SARS-CoV-2 spike protein; 2019-nCoV; COVID-2019; COVID-19; RBD (L452R); B.1.427; B1427; B.1.429; B1429; Californian Variant; United States variant; USA variant; U.S.A. variant; CAL.20C; L452R mutation of SARS-CoV-2 Spike; G/452R.V3
  • Species: SARS-CoV-2; Wuhan seafood market pneumonia virus
  • Tags: GFP/His-tag, C-terminal
  • Sequence without tags (AA 319-541):

    MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF
    KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN
    SNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF
    QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

    X indicates mutation sites

  • Expression Host: human, HEK293
  • Formulation: PBS, pH  7,4
  • Format: Liquid, stored and shipped at -80°C
  • Purity: > 95% as determined by SDS-PAGE

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors.
The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.427 and the related lineage B.1.429 exhibits 5 mutations in the spike protein. CDC has listed both lineages as “variants of concern”. Compared to the previously circulating variants, the mutations L452R of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 resulting in higher transmission and eventually also in reduced neutralization. The mutation L452R is also found in the variant B.1.617 first detected in India. This variant is also known as G/452R.V3.

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE of SARS-CoV-2 S1 RBD Mutant L452R, GFP/His-Tag
Histogram (of marked lane in gel picture) of SARS-CoV-2 S1 RBD Mutant L452R, GFP/His-Tag

Questions? Ask Zymi.

Zymi is trenzyme’s AI-powered assistant, here to help you find relevant information about our products and services.

Chat with Zymi

Do you need a quote for an individual request or a bulk order?

Contact Us